8GP3: Beta-arrestin1

Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human C-X-C chemokine receptor type 4, CXCR4. Determined by electron microscopy at 4.8 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 4.8 Å
Organisms: Rattus norvegicus, Homo sapiens, Mus musculus
Chains: 8
Atoms: 11,494
Mol. weight: 196.83 kDa
Released: 17 May 2023

Explore 8GP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GP3 contains 35 α-helices and 136 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-42	6	1
β-strand	53-64	12	4
β-strand	74-85	12	4
α-helix	99-108	10
β-strand	112-117	6	1
β-strand	127-129	3	5
α-helix	130-132	3
β-strand	140-142	3	5
β-strand	143-150	8	4
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-188	6	6
β-strand	197-203	7	6
β-strand	207-208	2	7
β-strand	214-221	8	6
β-strand	228-242	15	8
β-strand	246-258	13	8
β-strand	262	1	8
β-strand	267-274	8	6
α-helix	278-281	4
β-strand	288-290	3	5
β-strand	300	1	5
α-helix	301-304	4
β-strand	316-329	14	8
β-strand	343-349	7	8
β-strand	350-351	2	7
α-helix	353-356	4
α-helix	359-361	3
β-strand	367	1	9

Chain B: 9 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	10
β-strand	19-22	4	10
β-strand	26-28	3	11
β-strand	29	1	12
β-strand	34	1	12
β-strand	37-42	6	10
β-strand	53-64	12	13
β-strand	74-85	12	13
α-helix	99-108	10
β-strand	112-117	6	10
β-strand	127-129	3	13
α-helix	130-132	3
β-strand	140-150	11	13
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-166	4	13
β-strand	169-171	3	11
α-helix	180-182	3
β-strand	183-188	6	14
β-strand	197-203	7	14
β-strand	207-208	2	15
β-strand	214-221	8	14
β-strand	228-242	15	16
β-strand	246-258	13	16
β-strand	262	1	16
β-strand	267-274	8	14
α-helix	279-281	3
β-strand	288-290	3	13
β-strand	300	1	13
α-helix	301-305	5
β-strand	316-329	14	16
β-strand	343-349	7	16
β-strand	350-351	2	15
α-helix	353-356	4
α-helix	359-361	3
β-strand	367	1	17

Chains H and I: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	18
β-strand	14-15	2	19
β-strand	20-28	9	18
β-strand	35-42	8	20
β-strand	48-55	8	20
β-strand	60-63	4	20
β-strand	71-76	6	18
β-strand	81-87	7	18
α-helix	91-93	3
β-strand	95-103	9	20
β-strand	112-113	2	20
β-strand	117-119	3	20
β-strand	120-121	2	19
β-strand	127	1	21
β-strand	130-134	5	22
β-strand	147-155	9	22
β-strand	156	1	21
β-strand	161-164	4	23
α-helix	165-167	3
β-strand	174-175	2	22
β-strand	179-180	2	22
β-strand	186-193	8	22
β-strand	206-210	5	23
β-strand	215-217	3	23

Chain L: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	30
β-strand	11-14	4	31
β-strand	20-25	6	30
β-strand	34-39	6	31
β-strand	45-50	6	31
β-strand	54-55	2	31
α-helix	56	1
β-strand	63-68	6	30
β-strand	71-76	6	30
α-helix	81-83	3
β-strand	86-91	6	31
β-strand	94	1	9
β-strand	103-107	5	31
β-strand	112	1	32
α-helix	113-114	2
β-strand	115-119	5	33
α-helix	120-122	3
α-helix	124-128	5
β-strand	131-140	10	33
β-strand	141	1	32
β-strand	160-164	5	33
α-helix	165-168	4
β-strand	174-182	9	33
α-helix	184-189	6

Chain M: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	34
β-strand	11-14	4	35
β-strand	20-25	6	34
β-strand	34-39	6	35
β-strand	45-47	3	35
β-strand	49-50	2	36
β-strand	54-55	2	36
α-helix	56	1
β-strand	63-68	6	34
β-strand	71-76	6	34
α-helix	81-83	3
β-strand	86-91	6	35
β-strand	94	1	17
β-strand	103-107	5	35
β-strand	112	1	37
α-helix	113-114	2
β-strand	115-119	5	38
α-helix	120-122	3
α-helix	124-128	5
β-strand	131-140	10	38
β-strand	141	1	37
β-strand	160-164	5	38
β-strand	174-182	9	38
α-helix	184-189	6

Chains U and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	345-348	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	418	Rattus norvegicus	P29066 (AlphaFold model)
C-X-C chemokine receptor type 4	U, V	protein	17	Homo sapiens	P61073 (AlphaFold model)
Fab30 Heavy Chain	H, I	protein	237	Mus musculus
Fab30 Light Chain	L, M	protein	215	Mus musculus

Sequence of entity 1 (A, B), FASTA

>8GP3_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR

Sequence of entity 2 (U, V), FASTA

>8GP3_2 C-X-C chemokine receptor type 4 (chains U, V)
GHSSVSTESESSSFHSS

Sequence of entity 3 (H, I), FASTA

>8GP3_3 Fab30 Heavy Chain (chains H, I)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 4 (L, M), FASTA

>8GP3_4 Fab30 Light Chain (chains L, M)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor

Browse structure collections

About this viewer

MolViewer shows 8GP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.