8GQV: Swine SLA-2*HB01 Molecules

The Crystal Structures of a Swine SLA-2*HB01 Molecules Complexed with a CTL epitope from Asia1 serotype of Foot-and-mouth disease virus. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Jan 2023.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Sus scrofa, Foot-and-mouth disease virus
Chains: 6
Atoms: 6,436
Mol. weight: 88.47 kDa
Released: 11 Jan 2023

Explore 8GQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GQV contains 24 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	1
β-strand	19-28	10	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	1
α-helix	104	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-193	8	3
β-strand	199-208	10	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
α-helix	225-227	3
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	253-256	4
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
β-strand	49-50	2	6
α-helix	51-53	3
β-strand	54-55	2	6
β-strand	61-69	9	6
β-strand	77-82	6	7
β-strand	90-93	4	7

Chain D: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	8
β-strand	19-28	10	8
β-strand	31-37	7	8
β-strand	46-47	2	8
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	8
β-strand	109-118	10	8
β-strand	121-126	6	8
β-strand	133-135	3	8
α-helix	138-149	12
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-174	11
β-strand	183	1	9
α-helix	184-185	2
β-strand	186-192	7	10
β-strand	200-208	9	10
β-strand	209	1	9
β-strand	214-219	6	11
β-strand	222-223	2	11
β-strand	229-230	2	10
α-helix	231-233	3
β-strand	234-235	2	10
β-strand	241-248	8	10
α-helix	254-256	3
β-strand	257-262	6	11
β-strand	270-272	3	11

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	12
α-helix	4-5	2
β-strand	6-11	6	13
β-strand	21-30	10	13
β-strand	31	1	12
β-strand	36-41	6	14
β-strand	44	1	14
β-strand	49-50	2	13
α-helix	51-53	3
β-strand	54-55	2	13
β-strand	61-69	9	13
β-strand	77-82	6	14
β-strand	90-93	4	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A, D	protein	275	Sus scrofa	E3WHS2 (AlphaFold model)
beta 2 microglobulin	B, E	protein	98	Sus scrofa	Q07717 (AlphaFold model)
As64	C, F	protein	9	Foot-and-mouth disease virus	A2I7M2

Sequence of entity 1 (A, D), FASTA

>8GQV_1 MHC class I antigen (chains A, D)
GPHSLSYSYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIQQEGQEYW
DRETQISKETAQNYRVDLNTLRGYYNQSEAGSRTIQRVYGCYLGPDGLLLRGYRQDAYDG
ADYIALNEDLRSWTAADMAAQITKRKWEVVNEAEGERSYLQGRCVEWLQKYLVMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B, E), FASTA

>8GQV_2 beta 2 microglobulin (chains B, E)
VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWS
FYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C, F), FASTA

>8GQV_3 As64 (chains C, F)
ALLRSATYY

Primary citation

The Parallel Presentation of Two Functional CTL Epitopes Derived from the O and Asia 1 Serotypes of Foot-and-Mouth Disease Virus and Swine SLA-2*HB01: Implications for Universal Vaccine Development. Feng, L., Gao, Y.Y., Sun, M. et al. Cells (2022) 11. DOI 10.3390/cells11244017 · PubMed

Other PDB entries of the same protein (UniProt E3WHS2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GQW 2.48 Å, The Crystal Structures of a Swine SLA-2*HB01 Molecules Complexed with a CTL epitope from…

Browse structure collections

About this viewer

MolViewer shows 8GQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.