Cryo-EM structure of human Neuroligin 2. Determined by electron microscopy at 3.5 Å resolution. Released 1 Mar 2023.
Explore 8GS4 in 3D Show helices and sheets RCSB PDB PDBe
8GS4 contains 58 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 44-46 | 3 | 1 |
| β-strand | 49-51 | 3 | 1 |
| β-strand | 54-57 | 4 | 2 |
| β-strand | 65-68 | 4 | 2 |
| β-strand | 72-73 | 2 | 3 |
| α-helix | 76-78 | 3 | |
| β-strand | 97 | 1 | 1 |
| α-helix | 102-107 | 6 | |
| α-helix | 121-125 | 5 | |
| α-helix | 127-131 | 5 | |
| β-strand | 143-144 | 2 | 3 |
| β-strand | 147 | 1 | 4 |
| β-strand | 177-181 | 5 | 4 |
| β-strand | 182-183 | 2 | 5 |
| α-helix | 194-196 | 3 | |
| α-helix | 200-204 | 5 | |
| β-strand | 208-210 | 3 | 4 |
| β-strand | 212 | 1 | 3 |
| α-helix | 218-220 | 3 | |
| α-helix | 233-247 | 15 | |
| α-helix | 250-252 | 3 | |
| β-strand | 254-259 | 6 | 4 |
| β-strand | 260 | 1 | 6 |
| β-strand | 262-263 | 2 | 5 |
| α-helix | 265-267 | 3 | |
| α-helix | 269-272 | 4 | |
| β-strand | 286 | 1 | 6 |
| β-strand | 289-290 | 2 | 5 |
| α-helix | 304-308 | 5 | |
| α-helix | 312-315 | 4 | |
| α-helix | 326-329 | 4 | |
| α-helix | 344-345 | 2 | |
| α-helix | 364-367 | 4 | |
| β-strand | 379 | 1 | 7 |
| β-strand | 380-381 | 2 | 5 |
| β-strand | 382-383 | 2 | 8 |
| α-helix | 406-416 | 11 | |
| α-helix | 424-434 | 11 | |
| α-helix | 438-440 | 3 | |
| α-helix | 451-453 | 3 | |
| α-helix | 455-456 | 2 | |
| α-helix | 457-461 | 5 | |
| α-helix | 464-473 | 10 | |
| β-strand | 479 | 1 | 7 |
| β-strand | 482-483 | 2 | 8 |
| α-helix | 504-508 | 5 | |
| α-helix | 511-513 | 3 | |
| α-helix | 527-544 | 18 | |
| α-helix | 595-599 | 5 | |
| α-helix | 600-604 | 5 | |
| α-helix | 605-608 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuroligin-2 | A, B | protein | 835 | Homo sapiens | Q8NFZ4 (AlphaFold model) |
>8GS4_1 Neuroligin-2 (chains A, B) MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM LFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVV PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF WLELVPHLHNLHTELFTTTTRLPPYATRWPPRPPAGAPGTRRPPPPATLPPEPEPEPGPR AYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSGS GVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDV PLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
Expression and structural analysis of human neuroligin 2 and neuroligin 3 implicated in autism spectrum disorders. Zhang, Z., Hou, M., Ou, H. et al. Front Endocrinol (Lausanne) (2022) 13:1067529-1067529. DOI 10.3389/fendo.2022.1067529 · PubMed
Other PDB entries of the same protein (UniProt Q8NFZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8GS4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.