8GXM: Human SUGP1 433-586

Human SUGP1 433-586. Determined by X-ray diffraction at 2.81 Å resolution. Released 14 Dec 2022.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,058
Mol. weight: 36.77 kDa
Released: 14 Dec 2022

Explore 8GXM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GXM contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	439-478	40
α-helix	496-517	22
α-helix	531-545	15
α-helix	552-574	23

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	439-476	38
α-helix	496-516	21
α-helix	531-545	15
α-helix	552-571	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SURP and G-patch domain-containing protein 1	A, B	protein	154	Homo sapiens	Q8IWZ8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8GXM_1 SURP and G-patch domain-containing protein 1 (chains A, B)
GVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSE
LGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDY
SEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQ

Primary citation

DHX15 is involved in SUGP1-mediated RNA missplicing by mutant SF3B1 in cancer. Zhang, J., Huang, J., Xu, K. et al. Proc Natl Acad Sci U S A (2022) 119:e2216712119-e2216712119. DOI 10.1073/pnas.2216712119 · PubMed

Other PDB entries of the same protein (UniProt Q8IWZ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EJM 1.8 Å, Crystal structure of human DEAH-box helicase DHX15 in complex with SUGP1 G-patch
8GXL 2.4 Å, Human SUGP1 433-577

Browse structure collections

About this viewer

MolViewer shows 8GXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.