Crystal structure of voltage-gated sodium channel NavAb N49K mutant in calcium ion condition. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Jul 2023.
Explore 8H9W in 3D Show helices and sheets RCSB PDB PDBe
8H9W contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1002-1009 | 8 | |
| α-helix | 1012-1032 | 21 | |
| α-helix | 1035-1066 | 32 | |
| α-helix | 1070-1073 | 4 | |
| α-helix | 1075-1087 | 13 | |
| α-helix | 1098-1101 | 4 | |
| α-helix | 1102-1107 | 6 | |
| α-helix | 1108-1112 | 5 | |
| α-helix | 1114-1126 | 13 | |
| α-helix | 1128-1130 | 3 | |
| α-helix | 1131-1152 | 22 | |
| α-helix | 1157-1160 | 4 | |
| α-helix | 1163-1174 | 12 | |
| α-helix | 1179-1184 | 6 | |
| α-helix | 1185-1188 | 4 | |
| α-helix | 1195-1224 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ion transport protein | A | protein | 271 | Aliarcobacter butzleri | A8EVM5 (AlphaFold model) |
>8H9W_1 Ion transport protein (chains A) GSGSMYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFGVYTTLFKQIVITIF TIEIILRIYVHRISFFKDPWSLFDFFVVAISLVPTSSGFEILRVLRVLRLFRLVTAVPQM RKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMTL ESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMINLVVAIIVDAMAILNQKEEQHIIDEV QSHEDNINNEIIKLREEIVELKELIKTSLKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| LMT | Dodecyl-beta-D-maltoside | C24 H46 O11 | 2 |
| CA | Calcium ion | Ca | 1 |
| PX4 | 1,2-dimyristoyl-sn-glycero-3-phosphocholine | C36 H73 N O8 P | 8 |
| 1N7 | Chapso | C32 H59 N2 O8 S | 1 |
The structural basis of divalent cation block in a tetrameric prokaryotic sodium channel. Irie, K., Oda, Y., Sumikama, T. et al. Nat Commun (2023) 14:4236-4236. DOI 10.1038/s41467-023-39987-0 · PubMed
Other PDB entries of the same protein (UniProt A8EVM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8H9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.