Crystal structure of TMPRSS2 in complex with 212-148. Determined by X-ray diffraction at 2.4 Å resolution. Released 13 Dec 2023.
Explore 8HD8 in 3D Show helices and sheets RCSB PDB PDBe
8HD8 contains 30 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 118 | 1 | 1 |
| β-strand | 127 | 1 | 1 |
| α-helix | 129-131 | 3 | |
| β-strand | 149-152 | 4 | 2 |
| β-strand | 157-162 | 6 | 2 |
| β-strand | 167-170 | 4 | 2 |
| β-strand | 171 | 1 | 3 |
| β-strand | 172 | 1 | 2 |
| α-helix | 178-187 | 10 | |
| β-strand | 196-200 | 5 | 2 |
| β-strand | 209-212 | 4 | 3 |
| α-helix | 213 | 1 | |
| α-helix | 221-224 | 4 | |
| β-strand | 225-228 | 4 | 3 |
| β-strand | 236-240 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 114-116 | 3 | |
| β-strand | 118-119 | 2 | 10 |
| β-strand | 126-127 | 2 | 10 |
| α-helix | 129-131 | 3 | |
| β-strand | 149-152 | 4 | 11 |
| β-strand | 157-162 | 6 | 11 |
| β-strand | 167-170 | 4 | 11 |
| β-strand | 171 | 1 | 12 |
| β-strand | 172 | 1 | 11 |
| α-helix | 178-187 | 10 | |
| β-strand | 196-200 | 5 | 11 |
| β-strand | 209-212 | 4 | 12 |
| α-helix | 213 | 1 | |
| α-helix | 221-224 | 4 | |
| β-strand | 225-228 | 4 | 12 |
| β-strand | 236-240 | 5 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 257 | 1 | 4 |
| β-strand | 260-261 | 2 | 5 |
| α-helix | 262-263 | 2 | |
| β-strand | 270-275 | 6 | 6 |
| β-strand | 278-285 | 8 | 6 |
| β-strand | 290-293 | 4 | 6 |
| α-helix | 295-298 | 4 | |
| α-helix | 305-307 | 3 | |
| β-strand | 309-312 | 4 | 6 |
| β-strand | 316 | 1 | 7 |
| α-helix | 317-319 | 3 | |
| β-strand | 326-333 | 8 | 6 |
| β-strand | 338 | 1 | 8 |
| β-strand | 343 | 1 | 8 |
| β-strand | 347-351 | 5 | 6 |
| α-helix | 354-357 | 4 | |
| β-strand | 358 | 1 | 9 |
| β-strand | 361 | 1 | 9 |
| α-helix | 363-364 | 2 | |
| β-strand | 365 | 1 | 5 |
| α-helix | 366-368 | 3 | |
| β-strand | 378-383 | 6 | 5 |
| α-helix | 392-394 | 3 | |
| β-strand | 396 | 1 | 7 |
| β-strand | 398-405 | 8 | 5 |
| α-helix | 407-410 | 4 | |
| β-strand | 424-428 | 5 | 5 |
| β-strand | 435 | 1 | 4 |
| β-strand | 444-449 | 6 | 5 |
| β-strand | 452-461 | 10 | 5 |
| β-strand | 472-476 | 5 | 5 |
| α-helix | 477-492 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 257 | 1 | 13 |
| β-strand | 260-261 | 2 | 14 |
| α-helix | 262-263 | 2 | |
| β-strand | 270-275 | 6 | 15 |
| β-strand | 278-285 | 8 | 15 |
| β-strand | 290-293 | 4 | 15 |
| α-helix | 295-298 | 4 | |
| α-helix | 305-307 | 3 | |
| β-strand | 309-312 | 4 | 15 |
| β-strand | 316 | 1 | 16 |
| α-helix | 317-319 | 3 | |
| α-helix | 322-324 | 3 | |
| β-strand | 326-333 | 8 | 15 |
| β-strand | 347-351 | 5 | 15 |
| α-helix | 354-357 | 4 | |
| α-helix | 363-364 | 2 | |
| β-strand | 365 | 1 | 14 |
| α-helix | 366-368 | 3 | |
| β-strand | 378-383 | 6 | 14 |
| α-helix | 392-394 | 3 | |
| β-strand | 396 | 1 | 16 |
| β-strand | 398-405 | 8 | 14 |
| α-helix | 407-410 | 4 | |
| β-strand | 424-428 | 5 | 14 |
| β-strand | 435 | 1 | 13 |
| β-strand | 444-449 | 6 | 14 |
| β-strand | 452-461 | 10 | 14 |
| β-strand | 472-476 | 5 | 14 |
| α-helix | 477-492 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transmembrane protease serine 2 catalytic chain | A, B | protein | 146 | Homo sapiens | O15393 (AlphaFold model) |
| Transmembrane protease serine 2 catalytic chain | C, D | protein | 249 | Homo sapiens | O15393 (AlphaFold model) |
>8HD8_1 Transmembrane protease serine 2 catalytic chain (chains A, B) MGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSW HPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHS DACSSKAVVSLRCIACGVNLNDDDDK
>8HD8_2 Transmembrane protease serine 2 catalytic chain (chains C, D) IVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGIL RQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQP EQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVD SCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADGEFV EHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
| GBS | 4-carbamimidamidobenzoic acid | C8 H9 N3 O2 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Structure-based discovery of dual pathway inhibitors for SARS-CoV-2 entry. Wang, H., Yang, Q., Liu, X. et al. Nat Commun (2023) 14:7574-7574. DOI 10.1038/s41467-023-42527-5 · PubMed
Other PDB entries of the same protein (UniProt O15393 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HD8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.