8HFR: NPC-trapped pre-60S particle
NPC-trapped pre-60S particle. Determined by electron microscopy at 2.64 Å resolution. Released 12 Apr 2023.
- Method
- Electron microscopy
- Resolution
- 2.64 Å
- Organism
- Saccharomyces cerevisiae S288C
- Chains
- 61
- Atoms
- 152,374
- Mol. weight
- 2639.6 kDa
- Ligands
- MG
- Released
- 12 Apr 2023
Explore 8HFR in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8HFR contains 450 α-helices and 452 β-strands across 58 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain AN: 17 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 102-114 | 13 | |
| β-strand | 115-116 | 2 | 128 |
| β-strand | 121-123 | 3 | 128 |
| α-helix | 131-136 | 6 | |
| α-helix | 148-158 | 11 | |
| β-strand | 166-168 | 3 | 128 |
| α-helix | 180-182 | 3 | |
| α-helix | 183-186 | 4 | |
| β-strand | 192-194 | 3 | 128 |
| α-helix | 207-209 | 3 | |
| β-strand | 218-220 | 3 | 128 |
| α-helix | 225-228 | 4 | |
| α-helix | 232-239 | 8 | |
| β-strand | 245-246 | 2 | 128 |
| β-strand | 250 | 1 | 128 |
| β-strand | 252 | 1 | 129 |
| α-helix | 254-260 | 7 | |
| β-strand | 270 | 1 | 130 |
| α-helix | 275-294 | 20 | |
| α-helix | 296-302 | 7 | |
| β-strand | 309-314 | 6 | 130 |
| α-helix | 317-319 | 3 | |
| β-strand | 322 | 1 | 131 |
| α-helix | 334-336 | 3 | |
| α-helix | 347-352 | 6 | |
| β-strand | 355 | 1 | 130 |
| α-helix | 358-366 | 9 | |
| β-strand | 369 | 1 | 132 |
| β-strand | 372 | 1 | 130 |
| α-helix | 379-381 | 3 | |
| β-strand | 383-389 | 7 | 130 |
| β-strand | 394-404 | 11 | 130 |
| β-strand | 409 | 1 | 132 |
| α-helix | 433-435 | 3 | |
| β-strand | 442-452 | 11 | 130 |
| β-strand | 459-468 | 10 | 130 |
| β-strand | 473 | 1 | 24 |
Chain As: 7 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-19 | 13 | |
| β-strand | 20 | 1 | 8 |
| β-strand | 24 | 1 | 8 |
| β-strand | 33-38 | 6 | 9 |
| β-strand | 50-52 | 3 | 10 |
| β-strand | 67-68 | 2 | 11 |
| α-helix | 72-79 | 8 | |
| β-strand | 84-85 | 2 | 11 |
| α-helix | 87-95 | 9 | |
| α-helix | 97-106 | 10 | |
| β-strand | 111-113 | 3 | 12 |
| α-helix | 134-135 | 2 | |
| β-strand | 136-138 | 3 | 12 |
| α-helix | 144-153 | 10 | |
| β-strand | 156-158 | 3 | 10 |
| β-strand | 164-167 | 4 | 9 |
| α-helix | 176-193 | 18 | |
| β-strand | 201-207 | 7 | 9 |
Chain aw: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| α-helix | 42-48 | 7 | |
| α-helix | 65-68 | 4 | |
| β-strand | 72-73 | 2 | 61 |
| α-helix | 75-81 | 7 | |
| α-helix | 84-92 | 9 | |
| β-strand | 99 | 1 | 123 |
| β-strand | 101-103 | 3 | 62 |
| α-helix | 104-107 | 4 | |
| β-strand | 111-112 | 2 | 61 |
| β-strand | 124-127 | 4 | 62 |
| β-strand | 129-130 | 2 | 61 |
| α-helix | 132-141 | 10 | |
| β-strand | 144-147 | 4 | 62 |
Chain b3: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-18 | 7 | |
| β-strand | 22 | 1 | 13 |
| α-helix | 23-25 | 3 | |
| β-strand | 33 | 1 | 14 |
| β-strand | 35 | 1 | 14 |
| α-helix | 37-57 | 21 | |
Chain B4: 9 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 29-32 | 4 | |
| α-helix | 34-38 | 5 | |
| β-strand | 40-49 | 10 | 26 |
| β-strand | 58-64 | 7 | 26 |
| β-strand | 71-77 | 7 | 26 |
| α-helix | 78 | 1 | |
| β-strand | 79 | 1 | 27 |
| β-strand | 83 | 1 | 28 |
| β-strand | 87-91 | 5 | 26 |
| β-strand | 101-103 | 3 | 26 |
| α-helix | 104-106 | 3 | |
| β-strand | 112-114 | 3 | 26 |
| β-strand | 116 | 1 | 29 |
| β-strand | 126 | 1 | 29 |
| β-strand | 134-140 | 7 | 26 |
| β-strand | 145-149 | 5 | 26 |
| β-strand | 155-159 | 5 | 26 |
| β-strand | 163-166 | 4 | 26 |
| β-strand | 169 | 1 | 27 |
| α-helix | 174-176 | 3 | |
| α-helix | 182-189 | 8 | |
| α-helix | 201-203 | 3 | |
| β-strand | 224 | 1 | 30 |
| α-helix | 225-226 | 2 | |
| β-strand | 237 | 1 | 30 |
Chain Bt: 3 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-31 | 18 | |
| α-helix | 39-44 | 6 | |
| β-strand | 51-54 | 4 | 24 |
| β-strand | 58-59 | 2 | 24 |
| α-helix | 62-71 | 10 | |
| β-strand | 76-82 | 7 | 24 |
| β-strand | 86 | 1 | 24 |
| β-strand | 93-104 | 12 | 24 |
| β-strand | 109 | 1 | 25 |
| β-strand | 115 | 1 | 25 |
| β-strand | 117 | 1 | 129 |
| β-strand | 145-154 | 10 | 24 |
| β-strand | 168-175 | 8 | 24 |
| β-strand | 177 | 1 | 131 |
Chain cC: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-19 | 9 | |
| β-strand | 21-25 | 5 | 88 |
| α-helix | 27-35 | 9 | |
| β-strand | 41-45 | 5 | 88 |
| α-helix | 50-63 | 14 | |
| β-strand | 66-70 | 5 | 88 |
| α-helix | 74-81 | 8 | |
| β-strand | 89-95 | 7 | 88 |
Chain CD: 13 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-29 | 3 | |
| α-helix | 33-35 | 3 | |
| α-helix | 40-41 | 2 | |
| β-strand | 43 | 1 | 90 |
| β-strand | 45-60 | 16 | 91 |
| β-strand | 70-80 | 11 | 91 |
| β-strand | 84-95 | 12 | 92 |
| β-strand | 98-106 | 9 | 92 |
| α-helix | 112-118 | 7 | |
| α-helix | 133-137 | 5 | |
| α-helix | 143-153 | 11 | |
| β-strand | 157-163 | 7 | 92 |
| α-helix | 166-168 | 3 | |
| β-strand | 178-182 | 5 | 92 |
| β-strand | 183 | 1 | 90 |
| α-helix | 188-197 | 10 | |
| β-strand | 202-203 | 2 | 92 |
| α-helix | 205-207 | 3 | |
| β-strand | 214-220 | 7 | 91 |
| α-helix | 221-223 | 3 | |
| β-strand | 225-227 | 3 | 93 |
| α-helix | 229-233 | 5 | |
| α-helix | 235-238 | 4 | |
| β-strand | 268-270 | 3 | 93 |
| β-strand | 274-286 | 13 | 91 |
| β-strand | 311 | 1 | 94 |
| β-strand | 315 | 1 | 94 |
| β-strand | 321-325 | 5 | 91 |
| β-strand | 335-339 | 5 | 91 |
| β-strand | 356-359 | 4 | 91 |
| α-helix | 373-380 | 8 | |
50 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 60S ribosomal protein L35-A | h1 | protein | 120 | Saccharomyces cerevisiae S288C | P0CX84 (AlphaFold model) |
| 60S ribosomal protein L34-A | g2 | protein | 121 | Saccharomyces cerevisiae S288C | P87262 (AlphaFold model) |
| 60S ribosomal protein L29 | b3 | protein | 59 | Saccharomyces cerevisiae S288C | P05747 (AlphaFold model) |
| 60S ribosomal protein L2-A | B4 | protein | 254 | Saccharomyces cerevisiae S288C | P0CX45 (AlphaFold model) |
| 60S ribosomal protein L23-A | V5 | protein | 137 | Saccharomyces cerevisiae S288C | P0CX41 |
| 60S ribosomal protein L16-A | O6 | protein | 199 | Saccharomyces cerevisiae S288C | P26784 |
| 60S ribosomal protein L33-A | f7 | protein | 107 | Saccharomyces cerevisiae S288C | P05744 |
| 60S ribosomal protein L6-A | F8 | protein | 176 | Saccharomyces cerevisiae S288C | Q02326 |
| Nucleolar GTP-binding protein 2 | v9 | protein | 486 | Saccharomyces cerevisiae S288C | P53742 |
| Nucleolar GTP-binding protein 1 | rA | protein | 647 | Saccharomyces cerevisiae S288C | Q02892 |
| Ribosome biogenesis protein RLP24 | tB | protein | 199 | Saccharomyces cerevisiae S288C | Q07915 |
| 60S ribosomal protein L30 | cC | protein | 105 | Saccharomyces cerevisiae S288C | P14120 |
45 more molecules are not listed.
Sequence of entity 1 (h1), FASTA
>8HFR_1 60S ribosomal protein L35-A (chains h1)
MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIACVLTVINE
QQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA
Sequence of entity 2 (g2), FASTA
>8HFR_2 60S ribosomal protein L34-A (chains g2)
MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR
QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVKKVVKEQTEAAKKSEKKAK
K
Sequence of entity 3 (b3), FASTA
>8HFR_3 60S ribosomal protein L29 (chains b3)
MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAAKK
Sequence of entity 4 (B4), FASTA
>8HFR_4 60S ribosomal protein L2-A (chains B4)
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAK
VVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKP
GDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLL
KAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAA
RRTGLLRGSQKTQD
Sequence of entity 5 (V5), FASTA
>8HFR_5 60S ribosomal protein L23-A (chains V5)
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMA
TVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGK
ECADLWPRVASNSGVVV
Sequence of entity 6 (O6), FASTA
>8HFR_6 60S ribosomal protein L16-A (chains O6)
MSVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRK
ATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVV
PQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYAKKRAFTKKVAS
ANATAAESDVAKQLAALGY
Sequence of entity 7 (f7), FASTA
>8HFR_7 60S ribosomal protein L33-A (chains f7)
MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVR
GSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI
Sequence of entity 8 (F8), FASTA
>8HFR_8 60S ribosomal protein L6-A (chains F8)
MSAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQNKEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLKF
Sequence of entity 9 (v9), FASTA
>8HFR_9 Nucleolar GTP-binding protein 2 (chains v9)
MGTGKKEKSRRIREGDTKDGNLRVKGENFYRDSKRVKFLNMYTSGKEIRNKKGNLIRAAS
FQDSTIPDARVQPDRRWFGNTRVISQDALQHFRSALGETQKDTYQVLLRRNKLPMSLLEE
KDADESPKARILDTESYADAFGPKAQRKRPRLAASNLEDLVKATNEDITKYEEKQVLDAT
LGLMGNQEDKENGWTSAAKEAIFSKGQSKRIWNELYKVIDSSDVVIHVLDARDPLGTRCK
SVEEYMKKETPHKHLIYVLNKCDLVPTWVAAAWVKHLSKERPTLAFHASITNSFGKGSLI
QLLRQFSQLHTDRKQISVGFIGYPNTGKSSIINTLRKKKVCQVAPIPGETKVWQYITLMK
RIFLIDCPGIVPPSSKDSEEDILFRGVVRVEHVTHPEQYIPGVLKRCQVKHLERTYEISG
WKDATEFIEILARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVLPPEKEGEEKPKKK
EVEKTA
Sequence of entity 10 (rA), FASTA
>8HFR_10 Nucleolar GTP-binding protein 1 (chains rA)
MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKVKYTGEGFVEK
FEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISRAKSLVEQVARDYVRLLKFGQ
SLFQCKQLKRAALGRMATIVKKLRDPLAYLEQVRQHIGRLPSIDPNTRTLLICGYPNVGK
SSFLRCITKSDVDVQPYAFTTKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSI
YAIAHLRSCVLYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDE
ERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRIENKLKSQSRINNVLNK
IHVAQPQARDDVKRTPFIPESVKNLKKYDPEDPNRRKLARDIEAENGGAGVFNVNLKDKY
LLEDDEWKNDIMPEILDGKNVYDFLDPEIAAKLQALEEEEEKLENEGFYNSDDEEEIYDG
FEASEVDDIKEKAAWIRNRQKTMIAEARNRKSLKNKAIMPRSKLTKSFGKMEEHMSTLGH
DMSALQDKQNRAARKNRYVERGSDVVFGDQDALTASTENGVKLRQTDRLLDGVADGSMRS
KADRMAKMERRERNRHAKQGESDRHNAVSLSKHLFSGKRGVGKTDFR
Sequence of entity 11 (tB), FASTA
>8HFR_11 Ribosome biogenesis protein RLP24 (chains tB)
MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF
LRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQL
EKQKILLKNRRRNTKKIAF
Sequence of entity 12 (cC), FASTA
>8HFR_12 60S ribosomal protein L30 (chains cC)
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYA
MLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 237 |
Primary citation
Nuclear export of pre-60S particles through the nuclear pore complex. Li, Z., Chen, S., Zhao, L. et al. Nature (2023) 618:411-418. DOI 10.1038/s41586-023-06128-y · PubMed
Other PDB entries of the same protein (UniProt P0CX84 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9PN5 1.75 Å, Composite map of hypomethylated 80S ribosome treated with hygromycin B
- 8CCS 1.97 Å, 80S S. cerevisiae ribosome with ligands in hybrid-1 pre-translocation (PRE-H1) complex
- 8CDR 2.04 Å, Translocation intermediate 2 (TI-2) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8CEH 2.05 Å, Translocation intermediate 4 (TI-4) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8P8N 2.15 Å, Mouse RPL39 integrated into the yeast 60S ribosomal subunit
- 8PFR 2.15 Å, Mouse RPL39L integrated into the yeast 60S ribosomal subunit
- 8EVT 2.2 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
- 8T2Y 2.2 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA,…
- 8P8U 2.23 Å, Yeast 60S ribosomal subunit
- 8CGN 2.28 Å, Non-rotated 80S S. cerevisiae ribosome with ligands
- 8ZHC 2.3 Å, pre-frameshift complex of yeast 80S ribosome with eRF1 and mRNA of WNV
- 7UOO 2.34 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state
Browse structure collections
About this viewer
MolViewer shows 8HFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.