8HST: Rat beta-arrestin1

The structure of rat beta-arrestin1. Determined by X-ray diffraction at 2.66 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 5,904
Mol. weight: 93.01 kDa
Released: 19 Jul 2023

Explore 8HST in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HST contains 20 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	18-22	5	1
β-strand	26-29	4	2
β-strand	34	1	2
β-strand	37-43	7	1
α-helix	45-47	3
β-strand	52-64	13	3
β-strand	75-87	13	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	119-120	2
α-helix	123-125	3
β-strand	127-129	3	3
β-strand	139-151	13	3
α-helix	157-159	3
β-strand	164-168	5	3
β-strand	169-172	4	2
α-helix	181-183	3
β-strand	184-188	5	4
β-strand	197-203	7	4
β-strand	207-209	3	5
β-strand	214-222	9	4
β-strand	228-241	14	6
β-strand	247-258	12	6
β-strand	262	1	6
β-strand	266-274	9	4
α-helix	279-281	3
β-strand	288-289	2	3
β-strand	300	1	3
α-helix	301-304	4
α-helix	313-315	3
β-strand	317-329	13	6
β-strand	341-349	9	6
β-strand	350-352	3	5
α-helix	353-356	4
β-strand	386-390	5	1

Chain B: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	7
β-strand	19-22	4	7
β-strand	26-29	4	8
β-strand	34	1	8
β-strand	37-42	6	7
α-helix	45-47	3
β-strand	52-63	12	9
β-strand	75-86	12	9
α-helix	91-93	3
α-helix	99-108	10
β-strand	112-117	6	7
α-helix	119-120	2
α-helix	123-126	4
β-strand	127-129	3	9
β-strand	140-151	12	9
α-helix	160-162	3
β-strand	163-168	6	9
β-strand	169-172	4	8
α-helix	182-183	2
β-strand	184-188	5	10
β-strand	197-203	7	10
β-strand	207-209	3	11
β-strand	214-222	9	10
β-strand	228-241	14	12
β-strand	247-258	12	12
β-strand	262	1	12
β-strand	266-274	9	10
β-strand	288-289	2	9
β-strand	300	1	9
α-helix	301-305	5
α-helix	312-315	4
β-strand	317-329	13	12
β-strand	343-349	7	12
β-strand	350-352	3	11
α-helix	353-355	3
β-strand	386-390	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	414	Rattus norvegicus	P29066 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HST_1 Beta-arrestin-1 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV
VLVDPEYLKERRVYVTLTVAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPSSVTLQPGPEDTGKALGVDYEVKAFVAENLEEKIHK
RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHV
TNNTNKTVKKIKISVRQYADIVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLAS
SDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQ

Primary citation

GPCR targeting of E3 ubiquitin ligase MDM2 by inactive beta-arrestin. Yun, Y., Yoon, H.J., Jeong, Y. et al. Proc Natl Acad Sci U S A (2023) 120:e2301934120-e2301934120. DOI 10.1073/pnas.2301934120 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor
9DNG 3.52 Å, Structure of rat beta-arrestin 1 by fiducial-assisted cryo-EM

Browse structure collections

About this viewer

MolViewer shows 8HST directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.