X-ray structure of human PPAR alpha ligand binding domain-elafibranor-SRC1 coactivator peptide co-crystals obtained by soaking. Determined by X-ray diffraction at 1.65 Å resolution. Released 9 Aug 2023.
Explore 8HUQ in 3D Show helices and sheets RCSB PDB PDBe
8HUQ contains 19 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 203-217 | 15 | |
| α-helix | 222-229 | 8 | |
| α-helix | 238 | 1 | |
| β-strand | 239-241 | 3 | 1 |
| α-helix | 244-254 | 11 | |
| α-helix | 256-258 | 3 | |
| α-helix | 268-292 | 25 | |
| α-helix | 297-299 | 3 | |
| α-helix | 302-321 | 20 | |
| α-helix | 322-324 | 3 | |
| β-strand | 325-326 | 2 | 1 |
| β-strand | 329-332 | 4 | 1 |
| β-strand | 337-340 | 4 | 1 |
| α-helix | 341-345 | 5 | |
| α-helix | 348 | 1 | |
| α-helix | 351-353 | 3 | |
| α-helix | 356-367 | 12 | |
| α-helix | 372-383 | 12 | |
| α-helix | 394-415 | 22 | |
| α-helix | 422-450 | 29 | |
| α-helix | 452-454 | 3 | |
| α-helix | 458-464 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 688-694 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor alpha | A | protein | 273 | Homo sapiens | Q07869 (AlphaFold model) |
| 15-meric peptide from Nuclear receptor coactivator 1 | B | protein | 15 | Homo sapiens | Q15788 (AlphaFold model) |
>8HUQ_1 Peroxisome proliferator-activated receptor alpha (chains A) GSHMTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLV AKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYE AIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDI SLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
>8HUQ_2 15-meric peptide from Nuclear receptor coactivator 1 (chains B) LTERHKILHRLLQEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| MUO | 2-[2,6-dimethyl-4-[(~{E})-3-(4-methylsulfanylphenyl)-3-oxidanylidene-prop-1-eny… | C22 H24 O4 S | 1 |
Water and common crystallization additives (GOL) are not listed.
Functional and Structural Insights into the Human PPAR alpha / delta / gamma Targeting Preferences of Anti-NASH Investigational Drugs, Lanifibranor, Seladelpar, and Elafibranor. Kamata, S., Honda, A., Ishikawa, R. et al. Antioxidants (Basel) (2023) 12. DOI 10.3390/antiox12081523 · PubMed
Other PDB entries of the same protein (UniProt Q07869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.