8I0N: Beta-arrestin1

Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human C5a anaphylatoxin chemotactic receptor 1, C5aR1 (Local refine). Determined by electron microscopy at 3.26 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 3.26 Å
Organisms: Rattus norvegicus, Mus musculus, Homo sapiens
Chains: 8
Atoms: 9,141
Mol. weight: 197.47 kDa
Released: 17 May 2023

Explore 8I0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I0N contains 35 α-helices and 105 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
α-helix	35-36	2
β-strand	37-42	6	1
β-strand	54-64	11	4
β-strand	74-85	12	4
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	119-120	2
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	139	1
β-strand	140-149	10	4
α-helix	157-158	2
α-helix	160-162	3
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-189	7	5
α-helix	195	1
β-strand	196-203	8	5
β-strand	207-208	2	6
α-helix	212-213	2
β-strand	214-222	9	5
β-strand	228-241	14	7
β-strand	247-258	12	7
β-strand	262	1	7
β-strand	266-274	9	5
α-helix	279-281	3
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-306	6
β-strand	317-329	13	7
β-strand	339	1	8
β-strand	343-349	7	7
β-strand	350-351	2	6
α-helix	353-356	4
α-helix	360-362	3
β-strand	367	1	9

Chain B: 13 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	10
β-strand	19-22	4	10
β-strand	26-28	3	11
β-strand	29	1	12
β-strand	34	1	12
α-helix	35-36	2
β-strand	37-42	6	10
β-strand	54-64	11	13
β-strand	74-85	12	13
α-helix	91-93	3
α-helix	99-108	10
β-strand	112-117	6	10
α-helix	119-120	2
β-strand	127-129	3	13
α-helix	130-132	3
α-helix	139	1
β-strand	140-149	10	13
α-helix	157-158	2
α-helix	160-162	3
β-strand	163-168	6	13
β-strand	169-171	3	11
α-helix	180-182	3
β-strand	183-189	7	14
β-strand	196-203	8	14
β-strand	207-208	2	15
α-helix	212-213	2
β-strand	214-222	9	14
β-strand	228-241	14	8
β-strand	247-258	12	8
β-strand	262	1	8
β-strand	266-274	9	14
α-helix	279-281	3
β-strand	288-290	3	13
β-strand	300	1	13
α-helix	301-304	4
β-strand	317-329	13	8
β-strand	343-349	7	8
β-strand	350-351	2	15
α-helix	353-356	4
β-strand	367	1	16

Chain H: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	17
β-strand	14	1	18
β-strand	20-28	9	17
β-strand	35-42	8	19
β-strand	48-55	8	19
β-strand	60-63	4	19
β-strand	71-76	6	17
β-strand	81-87	7	17
α-helix	91-93	3
β-strand	95-103	9	19
β-strand	112-113	2	19
β-strand	117-119	3	19
β-strand	120	1	18

Chain I: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	20
β-strand	14	1	21
β-strand	20-28	9	20
β-strand	35-42	8	22
β-strand	48-55	8	22
β-strand	60-63	4	22
α-helix	65-67	3
β-strand	71-76	6	20
α-helix	77-79	3
β-strand	81-87	7	20
α-helix	91-93	3
β-strand	95-103	9	22
β-strand	112-113	2	22
β-strand	117-119	3	22
β-strand	120	1	21

Chain L: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	23
β-strand	11-13	3	24
β-strand	20-26	7	23
β-strand	34-39	6	24
β-strand	46-50	5	24
β-strand	54-55	2	24
α-helix	56	1
β-strand	63-68	6	23
β-strand	71-76	6	23
β-strand	86-91	6	24
β-strand	94	1	9
β-strand	98-99	2	24
β-strand	103-106	4	24

Chain M: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	25
β-strand	11-13	3	26
β-strand	20-26	7	25
β-strand	34-39	6	26
β-strand	46-50	5	26
β-strand	54-55	2	26
α-helix	56	1
β-strand	63-68	6	25
β-strand	71-76	6	25
α-helix	81-83	3
β-strand	86-91	6	26
β-strand	94	1	16
α-helix	97	1
β-strand	98-99	2	26
β-strand	103-106	4	26

Chains U and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	337-339	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	418	Rattus norvegicus	P29066 (AlphaFold model)
Fab30 heavy chain	H, I	protein	237	Mus musculus
Fab30 light chain	L, M	protein	215	Mus musculus
C5a anaphylatoxin chemotactic receptor 1	U, V	protein	20	Homo sapiens	P21730 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8I0N_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR

Sequence of entity 2 (H, I), FASTA

>8I0N_2 Fab30 heavy chain (chains H, I)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (L, M), FASTA

>8I0N_3 Fab30 light chain (chains L, M)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (U, V), FASTA

>8I0N_4 C5a anaphylatoxin chemotactic receptor 1 (chains U, V)
ESKSFTRSTVDTMAQKTQAV

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor
9DNG 3.52 Å, Structure of rat beta-arrestin 1 by fiducial-assisted cryo-EM

Browse structure collections

About this viewer

MolViewer shows 8I0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.