8I0Q: Beta-arrestin1

Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human C-X-C chemokine receptor type 4, CXCR4 (Local refine). Determined by electron microscopy at 4.45 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 4.45 Å
Organisms: Rattus norvegicus, Mus musculus, Homo sapiens
Chains: 8
Atoms: 8,842
Mol. weight: 196.83 kDa
Released: 17 May 2023

Explore 8I0Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I0Q contains 28 α-helices and 105 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	36-42	7	1
β-strand	53-64	12	4
β-strand	74-87	14	4
α-helix	91-93	3
α-helix	99-108	10
β-strand	112-118	7	1
α-helix	119-120	2
α-helix	124-126	3
β-strand	127-129	3	4
β-strand	141-150	10	4
β-strand	164-168	5	4
β-strand	169-171	3	2
β-strand	183-188	6	5
β-strand	197-203	7	5
β-strand	214-222	9	5
β-strand	228-242	15	6
β-strand	246-258	13	6
β-strand	262	1	6
β-strand	266-274	9	5
α-helix	279-281	3
β-strand	288-289	2	4
β-strand	300	1	4
α-helix	301-303	3
α-helix	308-310	3
β-strand	318-329	12	6
α-helix	336-338	3
β-strand	343-349	7	6
α-helix	353-356	4
β-strand	367	1	7

Chain B: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	8
β-strand	18-22	5	8
β-strand	26-29	4	9
β-strand	34	1	9
β-strand	36-43	8	8
β-strand	53-64	12	10
β-strand	74-87	14	10
α-helix	91-93	3
α-helix	99-108	10
β-strand	112-118	7	8
α-helix	119-120	2
α-helix	124-126	3
β-strand	127-129	3	10
β-strand	141-150	10	10
β-strand	164-168	5	10
β-strand	169-172	4	9
β-strand	183-188	6	11
β-strand	197-203	7	11
β-strand	214-222	9	11
β-strand	228-242	15	12
β-strand	246-258	13	12
β-strand	262	1	12
β-strand	266-274	9	11
α-helix	279-281	3
β-strand	288-289	2	10
α-helix	290-292	3
β-strand	300	1	10
α-helix	301-303	3
α-helix	308-310	3
β-strand	318-329	12	12
α-helix	336-338	3
β-strand	343-349	7	12
β-strand	367	1	13

Chain H: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	14
β-strand	14-15	2	15
β-strand	18	1	16
β-strand	23-26	4	14
β-strand	35-42	8	17
β-strand	49-55	7	17
β-strand	60-63	4	17
α-helix	65-67	3
β-strand	68	1	14
β-strand	71-76	6	14
β-strand	81-86	6	14
β-strand	89	1	16
α-helix	91-93	3
β-strand	96-103	8	17
β-strand	112-113	2	17
β-strand	117-118	2	17
β-strand	120-121	2	15

Chain I: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	18
β-strand	14-15	2	19
β-strand	18	1	20
β-strand	23-26	4	18
β-strand	35-42	8	21
β-strand	49-54	6	21
β-strand	61-63	3	21
α-helix	65-67	3
β-strand	68	1	18
β-strand	71-76	6	18
β-strand	81-86	6	18
β-strand	89	1	20
α-helix	91-93	3
β-strand	96-103	8	21
β-strand	112-113	2	21
β-strand	117-118	2	21
β-strand	120-121	2	19

Chain L: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	22
β-strand	11-12	2	23
β-strand	20-25	6	22
β-strand	34-39	6	24
β-strand	46-50	5	24
β-strand	54-55	2	24
α-helix	56	1
β-strand	63-68	6	22
β-strand	71-76	6	22
α-helix	81-83	3
β-strand	86-91	6	24
β-strand	94	1	7
α-helix	97	1
β-strand	99	1	24
β-strand	104-105	2	23

Chain M: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	25
β-strand	11-12	2	26
β-strand	20-26	7	25
β-strand	34-39	6	27
β-strand	46-50	5	27
β-strand	54-55	2	27
α-helix	56	1
β-strand	63-68	6	25
β-strand	71-76	6	25
α-helix	81-83	3
β-strand	86-91	6	27
β-strand	94	1	13
α-helix	97	1
β-strand	99	1	27
β-strand	104-105	2	26

Chains U and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	345-348	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	418	Rattus norvegicus	P29066 (AlphaFold model)
Fab30 Heavy Chain	H, I	protein	237	Mus musculus
Fab30 Light Chain	L, M	protein	215	Mus musculus
C-X-C chemokine receptor type 4	U, V	protein	17	Homo sapiens	P61073 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8I0Q_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR

Sequence of entity 2 (H, I), FASTA

>8I0Q_2 Fab30 Heavy Chain (chains H, I)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (L, M), FASTA

>8I0Q_3 Fab30 Light Chain (chains L, M)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (U, V), FASTA

>8I0Q_4 C-X-C chemokine receptor type 4 (chains U, V)
GHSSVSTESESSSFHSS

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor

Browse structure collections

About this viewer

MolViewer shows 8I0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.