8I79: KCTD7
Cryo-EM structure of KCTD7 in complex with Cullin3. Determined by electron microscopy at 2.8 Å resolution. Released 26 Jul 2023.
- Method
- Electron microscopy
- Resolution
- 2.8 Å
- Organisms
- Mus musculus, Homo sapiens
- Chains
- 10
- Atoms
- 16,293
- Mol. weight
- 391.47 kDa
- Released
- 26 Jul 2023
Explore 8I79 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8I79 contains 133 α-helices and 40 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 47-50 | 4 | |
| β-strand | 52-57 | 6 | 3 |
| β-strand | 60-65 | 6 | 3 |
| α-helix | 66-69 | 4 | |
| α-helix | 76-80 | 5 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 94 | 1 | |
| β-strand | 95-97 | 3 | 3 |
| α-helix | 104-112 | 9 | |
| α-helix | 119-121 | 3 | |
| α-helix | 122-132 | 11 | |
| α-helix | 135-142 | 8 | |
| α-helix | 145-157 | 13 | |
| α-helix | 163-181 | 19 | |
| β-strand | 185-192 | 8 | 4 |
| β-strand | 230-232 | 3 | 4 |
| α-helix | 241-254 | 14 | |
| β-strand | 258-263 | 6 | 4 |
| β-strand | 281-287 | 7 | 4 |
Chain B: 17 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-45 | 19 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-125 | 2 | |
| α-helix | 126-130 | 5 | |
| α-helix | 131-133 | 3 | |
| α-helix | 139-151 | 13 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-227 | 21 | |
| α-helix | 230-251 | 22 | |
| α-helix | 257-269 | 13 | |
Chain C: 18 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-45 | 19 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-125 | 2 | |
| α-helix | 126-130 | 5 | |
| α-helix | 131-133 | 3 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-192 | 13 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-227 | 21 | |
| α-helix | 230-251 | 22 | |
| α-helix | 257-266 | 10 | |
Chain D: 9 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 52-57 | 6 | 5 |
| β-strand | 60-65 | 6 | 5 |
| α-helix | 66-69 | 4 | |
| α-helix | 76-80 | 5 | |
| β-strand | 89 | 1 | 5 |
| α-helix | 94 | 1 | |
| β-strand | 95-97 | 3 | 5 |
| α-helix | 104-112 | 9 | |
| α-helix | 122-132 | 11 | |
| α-helix | 135-142 | 8 | |
| α-helix | 145-157 | 13 | |
| α-helix | 163-181 | 19 | |
| β-strand | 185-192 | 8 | 6 |
| β-strand | 230-232 | 3 | 6 |
| α-helix | 241-254 | 14 | |
| β-strand | 258-263 | 6 | 6 |
| β-strand | 281-287 | 7 | 6 |
Chain E: 18 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-45 | 19 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-95 | 6 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-125 | 2 | |
| α-helix | 126-130 | 5 | |
| α-helix | 131-133 | 3 | |
| α-helix | 136-138 | 3 | |
| α-helix | 139-151 | 13 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-227 | 21 | |
| α-helix | 230-251 | 22 | |
| α-helix | 257-266 | 10 | |
Chains F and G: 8 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 52-57 | 6 | 1 |
| β-strand | 60-65 | 6 | 1 |
| α-helix | 66-69 | 4 | |
| α-helix | 76-80 | 5 | |
| β-strand | 89 | 1 | 1 |
| β-strand | 95-97 | 3 | 1 |
| α-helix | 104-112 | 9 | |
| α-helix | 122-132 | 11 | |
| α-helix | 135-142 | 8 | |
| α-helix | 145-157 | 13 | |
| α-helix | 163-181 | 19 | |
| β-strand | 185-192 | 8 | 2 |
| β-strand | 230-232 | 3 | 2 |
| α-helix | 241-254 | 14 | |
| β-strand | 258-263 | 6 | 2 |
| β-strand | 281-287 | 7 | 2 |
Chain H: 17 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-45 | 19 | |
| α-helix | 54-66 | 13 | |
| α-helix | 70-84 | 15 | |
| α-helix | 85-89 | 5 | |
| α-helix | 90-94 | 5 | |
| α-helix | 101-122 | 22 | |
| α-helix | 124-125 | 2 | |
| α-helix | 126-130 | 5 | |
| α-helix | 131-133 | 3 | |
| α-helix | 139-151 | 13 | |
| α-helix | 155-174 | 20 | |
| α-helix | 180-193 | 14 | |
| α-helix | 199-201 | 3 | |
| α-helix | 202-206 | 5 | |
| α-helix | 207-223 | 17 | |
| α-helix | 230-251 | 22 | |
| α-helix | 257-269 | 13 | |
Chain I: 9 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 47-50 | 4 | |
| β-strand | 52-57 | 6 | 9 |
| β-strand | 60-65 | 6 | 9 |
| α-helix | 66-69 | 4 | |
| α-helix | 76-80 | 5 | |
| β-strand | 89 | 1 | 9 |
| β-strand | 95-97 | 3 | 9 |
| α-helix | 104-112 | 9 | |
| α-helix | 122-132 | 11 | |
| α-helix | 135-142 | 8 | |
| α-helix | 145-157 | 13 | |
| α-helix | 163-181 | 19 | |
| β-strand | 185-192 | 8 | 10 |
| β-strand | 230-232 | 3 | 10 |
| α-helix | 241-254 | 14 | |
| β-strand | 258-263 | 6 | 10 |
| β-strand | 281-287 | 7 | 10 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| BTB/POZ domain-containing protein KCTD7 | A, D, F, G, I | protein | 297 | Mus musculus | Q8BJK1 (AlphaFold model) |
| Cullin-3 | B, C, E, H, J | protein | 376 | Homo sapiens | Q13618 (AlphaFold model) |
Sequence of entity 1 (A, D, F, G, I), FASTA
>8I79_1 BTB/POZ domain-containing protein KCTD7 (chains A, D, F, G, I)
DYKDDDDKMVVVTGREPDSRHSDGAMSSSEAEDDFLEPATPTATQAGHGLPLLPQEFPEV
VPLNIGGAHFTTRLSTLRRYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLR
SGDLPPREHVRAVYKEAQYYAIGPLLEQLENMQPLKGEKVRQAFLGLMPYYKDHLERIVE
IARLRAVQRKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSF
GPWEAVADVYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW
Sequence of entity 2 (B, C, E, H, J), FASTA
>8I79_2 Cullin-3 (chains B, C, E, H, J)
MHHHHHHGSPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEK
LYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQ
QNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMI
LGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCL
DKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKT
MCECMSSYLREQGKALVSEEGEGKNPVDYRQGLDDLKSRFDRFLLESFNNDRLFKQTIAG
DFEYFLNLNSRSPEYL
Primary citation
Structural basis for the ubiquitination of G protein beta gamma subunits by KCTD5/Cullin3 E3 ligase. Jiang, W., Wang, W., Kong, Y. et al. Sci Adv (2023) 9:eadg8369-eadg8369. DOI 10.1126/sciadv.adg8369 · PubMed
Browse structure collections
About this viewer
MolViewer shows 8I79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.