Structure of the LAH31 Fab bound to an influenza virus HA epitope peptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 26 Jul 2023.
Explore 8IB1 in 3D Show helices and sheets RCSB PDB PDBe
8IB1 contains 19 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-32 | 4 | 1 |
| β-strand | 35-38 | 4 | 2 |
| β-strand | 44-50 | 7 | 1 |
| β-strand | 55 | 1 | 3 |
| β-strand | 61 | 1 | 3 |
| β-strand | 63-68 | 6 | 2 |
| β-strand | 75-79 | 5 | 2 |
| β-strand | 83-84 | 2 | 2 |
| α-helix | 85 | 1 | |
| β-strand | 92-97 | 6 | 1 |
| β-strand | 100-105 | 6 | 1 |
| α-helix | 110-112 | 3 | |
| β-strand | 114-123 | 10 | 2 |
| β-strand | 126-129 | 4 | 2 |
| β-strand | 133-137 | 5 | 2 |
| β-strand | 142 | 1 | 4 |
| α-helix | 143-144 | 2 | |
| β-strand | 145-149 | 5 | 5 |
| α-helix | 150-152 | 3 | |
| α-helix | 153-156 | 4 | |
| β-strand | 160-170 | 11 | 5 |
| β-strand | 171 | 1 | 4 |
| β-strand | 176-181 | 6 | 6 |
| β-strand | 184-185 | 2 | 6 |
| α-helix | 186 | 1 | |
| β-strand | 190-194 | 5 | 5 |
| α-helix | 195-198 | 4 | |
| β-strand | 204-213 | 10 | 5 |
| α-helix | 214-217 | 4 | |
| β-strand | 222-228 | 7 | 6 |
| β-strand | 236-241 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-31 | 2 | 7 |
| β-strand | 35-37 | 3 | 8 |
| β-strand | 43-48 | 6 | 7 |
| α-helix | 51-55 | 5 | |
| β-strand | 58-64 | 7 | 8 |
| β-strand | 70-77 | 8 | 8 |
| α-helix | 78-80 | 3 | |
| β-strand | 82-85 | 4 | 8 |
| α-helix | 87-89 | 3 | |
| β-strand | 93-98 | 6 | 7 |
| β-strand | 103-108 | 6 | 7 |
| α-helix | 113-115 | 3 | |
| β-strand | 117-124 | 8 | 8 |
| α-helix | 127-129 | 3 | |
| β-strand | 133-136 | 4 | 8 |
| β-strand | 140-144 | 5 | 8 |
| β-strand | 151 | 1 | 9 |
| α-helix | 152-153 | 2 | |
| β-strand | 154-158 | 5 | 10 |
| β-strand | 169-179 | 11 | 10 |
| β-strand | 180 | 1 | 9 |
| β-strand | 185-188 | 4 | 11 |
| α-helix | 189-191 | 3 | |
| β-strand | 193 | 1 | 11 |
| β-strand | 197-199 | 3 | 10 |
| α-helix | 200-202 | 3 | |
| β-strand | 203-204 | 2 | 10 |
| β-strand | 210-219 | 10 | 10 |
| α-helix | 220-222 | 3 | |
| β-strand | 229-234 | 6 | 11 |
| α-helix | 235-237 | 3 | |
| β-strand | 239-244 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LAH31 Fab light chain | A | protein | 245 | Homo sapiens | |
| LAH31 Fab heavy chain | B | protein | 271 | Homo sapiens | |
| Hemagglutinin HA2 chain | C | protein | 15 | Influenza A virus | Q91MA7 |
>8IB1_1 LAH31 Fab light chain (chains A) MDAMKRGLCCVLLLCGAVFVSPSASDIVMTQSPLSLPVIPGEPASISCRSSQSLLQSNGN NYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCLQ ARQSSVLTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC
>8IB1_2 LAH31 Fab heavy chain (chains B) MDAMKRGLCCVLLLCGAVFVSPSASQVQLEQSGAEVKKPGSSVKVSCKASGPMFSRSAFS WVRQAPGQGLEWMGRIIPTVDLKNYAQKFQGRVTFTADKSTATSYMELRSLKSEDTAVYY CARMGSGSSYYGMDVWGLGTTVTVSSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK VDKRVEPKSCDKGSSLEVLFQGPLGHHHHHH
>8IB1_3 Hemagglutinin HA2 chain (chains C) VALENQHTIDLTDSE
Structural basis for cross-group recognition of an influenza virus hemagglutinin antibody that targets postfusion stabilized epitope. Tonouchi, K., Adachi, Y., Suzuki, T. et al. PLoS Pathog (2023) 19:e1011554-e1011554. DOI 10.1371/journal.ppat.1011554 · PubMed
Other PDB entries of the same protein (UniProt Q91MA7), best resolution first:
MolViewer shows 8IB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.