8IBG: Cytochrome b-c1 complex subunit 1, mitochondrial
Respiratory complex CIII2, focus-refined of type II, Wild type mouse under cold temperature. Determined by electron microscopy at 3.8 Å resolution. Released 18 Sept 2024.
- Method
- Electron microscopy
- Resolution
- 3.8 Å
- Organism
- Mus musculus
- Chains
- 22
- Atoms
- 30,396
- Mol. weight
- 584.55 kDa
- Ligands
- CDL, 3PH, U10, 3PE
- Released
- 18 Sept 2024
Explore 8IBG in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8IBG contains 192 α-helices and 115 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain Aa: 22 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 50-52 | 3 | 16 |
| β-strand | 58-63 | 6 | 16 |
| β-strand | 68-75 | 8 | 16 |
| α-helix | 79-81 | 3 | |
| α-helix | 89-96 | 8 | |
| β-strand | 101 | 1 | 17 |
| α-helix | 108-116 | 9 | |
| α-helix | 118 | 1 | |
| β-strand | 119-124 | 6 | 16 |
| β-strand | 129-136 | 8 | 16 |
| α-helix | 137-139 | 3 | |
| α-helix | 140-151 | 12 | |
| β-strand | 154 | 1 | 17 |
| α-helix | 161-175 | 15 | |
| α-helix | 179-186 | 8 | |
| α-helix | 205-209 | 5 | |
| α-helix | 213-223 | 11 | |
| α-helix | 226-228 | 3 | |
| β-strand | 229-235 | 7 | 16 |
| α-helix | 239-248 | 10 | |
| β-strand | 273-278 | 6 | 18 |
| β-strand | 285-292 | 8 | 18 |
| α-helix | 301-311 | 11 | |
| β-strand | 342-348 | 7 | 18 |
| β-strand | 351-360 | 10 | 18 |
| α-helix | 362-364 | 3 | |
| α-helix | 365-381 | 17 | |
| α-helix | 385-396 | 12 | |
| α-helix | 402-404 | 3 | |
| α-helix | 406-419 | 14 | |
| α-helix | 426-434 | 9 | |
| α-helix | 438-448 | 11 | |
| α-helix | 452-454 | 3 | |
| β-strand | 455-460 | 6 | 18 |
| α-helix | 468-474 | 7 | |
Chain AA: 23 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 49-52 | 4 | 1 |
| β-strand | 58-63 | 6 | 1 |
| β-strand | 68-75 | 8 | 1 |
| α-helix | 79-81 | 3 | |
| α-helix | 89-96 | 8 | |
| β-strand | 101 | 1 | 2 |
| β-strand | 104 | 1 | 2 |
| α-helix | 108-115 | 8 | |
| α-helix | 118 | 1 | |
| β-strand | 119-124 | 6 | 1 |
| β-strand | 129-136 | 8 | 1 |
| α-helix | 137-139 | 3 | |
| α-helix | 140-151 | 12 | |
| β-strand | 154 | 1 | 2 |
| α-helix | 158-175 | 18 | |
| α-helix | 179-191 | 13 | |
| α-helix | 196-198 | 3 | |
| α-helix | 205-209 | 5 | |
| α-helix | 213-223 | 11 | |
| α-helix | 226-228 | 3 | |
| β-strand | 229-235 | 7 | 1 |
| α-helix | 239-248 | 10 | |
| β-strand | 273-278 | 6 | 3 |
| β-strand | 279 | 1 | 4 |
| β-strand | 285-292 | 8 | 3 |
| α-helix | 301-311 | 11 | |
| β-strand | 342-348 | 7 | 3 |
| β-strand | 351-360 | 10 | 3 |
| α-helix | 362-364 | 3 | |
| α-helix | 365-379 | 15 | |
| α-helix | 385-396 | 12 | |
| α-helix | 402-404 | 3 | |
| α-helix | 406-419 | 14 | |
| α-helix | 426-434 | 9 | |
| α-helix | 438-448 | 11 | |
| β-strand | 455-460 | 6 | 3 |
| α-helix | 466-467 | 2 | |
| α-helix | 468-472 | 5 | |
Chain Ab: 19 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 41-42 | 2 | 19 |
| β-strand | 48-51 | 4 | 19 |
| β-strand | 58-65 | 8 | 19 |
| α-helix | 69-71 | 3 | |
| α-helix | 79-85 | 7 | |
| α-helix | 90 | 1 | |
| β-strand | 91 | 1 | 20 |
| β-strand | 94 | 1 | 20 |
| α-helix | 96-106 | 11 | |
| β-strand | 109-114 | 6 | 19 |
| β-strand | 119-126 | 8 | 19 |
| α-helix | 130-142 | 13 | |
| β-strand | 144 | 1 | 20 |
| α-helix | 148-164 | 17 | |
| α-helix | 169-181 | 13 | |
| β-strand | 182 | 1 | 21 |
| α-helix | 202-212 | 11 | |
| α-helix | 215-217 | 3 | |
| β-strand | 218-223 | 6 | 19 |
| α-helix | 227-237 | 11 | |
| α-helix | 238-240 | 3 | |
| β-strand | 253 | 1 | 21 |
| β-strand | 256-261 | 6 | 22 |
| β-strand | 266-275 | 10 | 22 |
| α-helix | 281-293 | 13 | |
| β-strand | 299 | 1 | 16 |
| α-helix | 308-314 | 7 | |
| β-strand | 321-330 | 10 | 22 |
| β-strand | 333-343 | 11 | 22 |
| α-helix | 347-362 | 16 | |
| α-helix | 368-386 | 19 | |
| α-helix | 389-403 | 15 | |
| α-helix | 409-418 | 10 | |
| α-helix | 421-433 | 13 | |
| α-helix | 435 | 1 | |
| β-strand | 436-442 | 7 | 22 |
Chain AB: 17 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 39-42 | 4 | 5 |
| β-strand | 48-52 | 5 | 5 |
| β-strand | 58-65 | 8 | 5 |
| α-helix | 69-71 | 3 | |
| α-helix | 79-85 | 7 | |
| β-strand | 91 | 1 | 6 |
| β-strand | 94 | 1 | 6 |
| α-helix | 96-105 | 10 | |
| β-strand | 109-114 | 6 | 5 |
| β-strand | 119-126 | 8 | 5 |
| α-helix | 130-142 | 13 | |
| β-strand | 144 | 1 | 6 |
| α-helix | 148-165 | 18 | |
| α-helix | 169-181 | 13 | |
| β-strand | 182 | 1 | 7 |
| α-helix | 202-212 | 11 | |
| α-helix | 215-217 | 3 | |
| β-strand | 218-223 | 6 | 5 |
| α-helix | 227-236 | 10 | |
| α-helix | 246-251 | 6 | |
| β-strand | 253 | 1 | 7 |
| β-strand | 256-261 | 6 | 8 |
| β-strand | 266-275 | 10 | 8 |
| α-helix | 281-292 | 12 | |
| α-helix | 308-316 | 9 | |
| β-strand | 321-330 | 10 | 8 |
| β-strand | 333-343 | 11 | 8 |
| α-helix | 347-362 | 16 | |
| α-helix | 368-386 | 19 | |
| α-helix | 389-403 | 15 | |
| α-helix | 409-418 | 10 | |
| α-helix | 421-433 | 13 | |
| β-strand | 436-442 | 7 | 8 |
Chain Ac: 22 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-18 | 8 | |
| β-strand | 23-24 | 2 | 23 |
| α-helix | 29-32 | 4 | |
| α-helix | 33-52 | 20 | |
| α-helix | 62-71 | 10 | |
| α-helix | 76-103 | 28 | |
| α-helix | 106-108 | 3 | |
| α-helix | 110-132 | 23 | |
| β-strand | 136 | 1 | 24 |
| α-helix | 137-151 | 15 | |
| α-helix | 157-165 | 9 | |
| α-helix | 172-201 | 30 | |
| α-helix | 213-215 | 3 | |
| β-strand | 217-218 | 2 | 23 |
| α-helix | 225-243 | 19 | |
| α-helix | 253-256 | 4 | |
| β-strand | 258 | 1 | 24 |
| α-helix | 259 | 1 | |
| α-helix | 272-274 | 3 | |
| α-helix | 275-283 | 9 | |
| α-helix | 287-303 | 17 | |
| α-helix | 304-306 | 3 | |
| α-helix | 319-340 | 22 | |
| α-helix | 347-360 | 14 | |
| α-helix | 361-365 | 5 | |
| α-helix | 366-377 | 12 | |
Chain AC: 20 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-18 | 8 | |
| β-strand | 23-24 | 2 | 9 |
| α-helix | 30-32 | 3 | |
| α-helix | 33-52 | 20 | |
| α-helix | 62-71 | 10 | |
| α-helix | 76-103 | 28 | |
| α-helix | 106-108 | 3 | |
| α-helix | 110-132 | 23 | |
| β-strand | 136 | 1 | 10 |
| α-helix | 137-151 | 15 | |
| α-helix | 157-165 | 9 | |
| α-helix | 172-201 | 30 | |
| α-helix | 213-215 | 3 | |
| β-strand | 217-218 | 2 | 9 |
| α-helix | 225-243 | 19 | |
| α-helix | 253-256 | 4 | |
| β-strand | 258 | 1 | 10 |
| α-helix | 272-283 | 12 | |
| α-helix | 287-303 | 17 | |
| α-helix | 304-307 | 4 | |
| α-helix | 319-340 | 22 | |
| α-helix | 347-360 | 14 | |
| α-helix | 361-365 | 5 | |
| α-helix | 366-376 | 11 | |
Chain Ad: 14 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 89-91 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 131 | 1 | 25 |
| α-helix | 132-135 | 4 | |
| β-strand | 137 | 1 | 26 |
| β-strand | 140 | 1 | 26 |
| α-helix | 142-151 | 10 | |
| β-strand | 153 | 1 | 27 |
| β-strand | 168 | 1 | 27 |
| β-strand | 174 | 1 | 25 |
| α-helix | 182-188 | 7 | |
| α-helix | 200-203 | 4 | |
| α-helix | 207-216 | 10 | |
| α-helix | 219-222 | 4 | |
| α-helix | 227-228 | 2 | |
| β-strand | 232 | 1 | 28 |
| α-helix | 238-240 | 3 | |
| β-strand | 242 | 1 | 28 |
| α-helix | 263-278 | 16 | |
| α-helix | 282-312 | 31 | |
| α-helix | 313-315 | 3 | |
| β-strand | 318-321 | 4 | 18 |
Chain AD: 11 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 107-119 | 13 | |
| α-helix | 121-123 | 3 | |
| β-strand | 131 | 1 | 11 |
| α-helix | 132-135 | 4 | |
| α-helix | 142-150 | 9 | |
| β-strand | 157 | 1 | 12 |
| β-strand | 167 | 1 | 12 |
| α-helix | 173 | 1 | |
| β-strand | 174 | 1 | 11 |
| α-helix | 175-176 | 2 | |
| α-helix | 182-187 | 6 | |
| α-helix | 200-203 | 4 | |
| α-helix | 207-215 | 9 | |
| α-helix | 263-278 | 16 | |
| α-helix | 282-316 | 35 | |
| β-strand | 318-321 | 4 | 3 |
13 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cytochrome b-c1 complex subunit 1, mitochondrial | AA, Aa | protein | 480 | Mus musculus | Q9CZ13 (AlphaFold model) |
| Cytochrome b-c1 complex subunit 2, mitochondrial | AB, Ab | protein | 453 | Mus musculus | Q9DB77 (AlphaFold model) |
| Cytochrome b | AC, Ac | protein | 381 | Mus musculus | P00158 (AlphaFold model) |
| Cytochrome c1, heme protein, mitochondrial | AD, Ad | protein | 325 | Mus musculus | Q9D0M3 (AlphaFold model) |
| Cytochrome b-c1 complex subunit Rieske, mitochondrial | AE, AI, Ae, Ai | protein | 274 | Mus musculus | Q9CR68 |
| Cytochrome b-c1 complex subunit 7 | AF, Af | protein | 111 | Mus musculus | Q9CQB4 |
| Cytochrome b-c1 complex subunit 8 | AG, Ag | protein | 82 | Mus musculus | Q9CQ69 |
| Cytochrome b-c1 complex subunit 6, mitochondrial | AH, Ah | protein | 89 | Mus musculus | P99028 |
| Cytochrome b-c1 complex subunit 9 | AJ, Aj | protein | 64 | Mus musculus | Q8R1I1 |
| Cytochrome b-c1 complex subunit 10 | AK, Ak | protein | 56 | Mus musculus | Q9CPX8 |
Sequence of entity 1 (AA, Aa), FASTA
>8IBG_1 Cytochrome b-c1 complex subunit 1, mitochondrial (chains AA, Aa)
MAASAVCRAACSGTQVLLRTRRSPALLRLPALRGTATFAQALQSVPETQVSILDNGLRVA
SEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHL
NAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQ
NVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPD
NVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVC
DAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
Sequence of entity 2 (AB, Ab), FASTA
>8IBG_2 Cytochrome b-c1 complex subunit 2, mitochondrial (chains AB, Ab)
MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSR
IGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDV
AYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNM
RGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIK
RGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKA
VAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVA
DADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL
Sequence of entity 3 (AC, Ac), FASTA
>8IBG_3 Cytochrome b (chains AC, Ac)
MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTM
TAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLL
FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFA
FHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILM
TLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILI
LALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFS
IILILMPISGIIEDKMLKLYP
Sequence of entity 4 (AD, Ad), FASTA
>8IBG_4 Cytochrome c1, heme protein, mitochondrial (chains AD, Ad)
MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYP
NPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLL
PLTYAMKRHKWSVLKSRKLAYRPPK
Sequence of entity 5 (AE, AI, Ae, Ai), FASTA
>8IBG_5 Cytochrome b-c1 complex subunit Rieske, mitochondrial (chains AE, AI, Ae, Ai)
MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAA
ARPLVATVGLNVPASVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG
Sequence of entity 6 (AF, Af), FASTA
>8IBG_6 Cytochrome b-c1 complex subunit 7 (chains AF, Af)
MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRM
FRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK
Sequence of entity 7 (AG, Ag), FASTA
>8IBG_7 Cytochrome b-c1 complex subunit 8 (chains AG, Ag)
MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIY
TWGNQEFEQSKRKNPAMYENDK
Sequence of entity 8 (AH, Ah), FASTA
>8IBG_8 Cytochrome b-c1 complex subunit 6, mitochondrial (chains AH, Ah)
MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQ
TEEDCTEELFDFLHARDHCVAHKLFKNLK
Sequence of entity 9 (AJ, Aj), FASTA
>8IBG_9 Cytochrome b-c1 complex subunit 9 (chains AJ, Aj)
MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
ENKE
Sequence of entity 10 (AK, Ak), FASTA
>8IBG_10 Cytochrome b-c1 complex subunit 10 (chains AK, Ak)
MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CDL | Cardiolipin | C81 H156 O17 P2 | 2 |
| 3PH | 1,2-diacyl-glycerol-3-sn-phosphate | C39 H77 O8 P | 1 |
| U10 | Ubiquinone-10 | C59 H90 O4 | 1 |
| 3PE | 1,2-Distearoyl-sn-glycerophosphoethanolamine | C41 H82 N O8 P | 3 |
| HEC | Heme C | C34 H36 Fe N4 O4 | 2 |
| UQ6 | 5-(3,7,11,15,19,23-hexamethyl-tetracosa-2,6,10,14,18,22-hexaenyl)-2,3-dimethoxy… | C39 H60 O4 | 2 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 4 |
Primary citation
Structural basis of respiratory complex adaptation to cold temperatures. Shin, Y.C., Latorre-Muro, P., Djurabekova, A. et al. Cell (2024) 187:6584. DOI 10.1016/j.cell.2024.09.029 · PubMed
Other PDB entries of the same protein (UniProt Q9CZ13 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7O3H 2.6 Å, Murine CIII2 focus-refined from supercomplex CICIII2
- 7O37 3.2 Å, Murine supercomplex CIII2CIV in the assembled locked conformation
- 7O3C 3.3 Å, Murine supercomplex CIII2CIV in the mature unlocked conformation
- 8PW6 3.3 Å, C respirasome from murine liver
- 8IAR 3.4 Å, Respiratory complex CIII2, focus-refined of type I, Wild type mouse under thermoneutral…
- 8IB7 3.4 Å, Respiratory complex CIII2, focus-refined of type IA, Wild type mouse under cold…
- 8PW7 3.5 Å, A respirasome from murine liver
- 7O3E 3.6 Å, Murine supercomplex CIII2CIV in the intermediate locked conformation
- 8IBC 3.6 Å, Respiratory complex CIII2, focus-refined of type IB, Wild type mouse under cold…
- 8PW5 3.6 Å, CS respirasome from murine liver
- 8UCA 3.7 Å, Formation of I2+III2 supercomplex rescues respiratory chain defects
- 8IC5 4.1 Å, Respiratory complex CIII2, focus-refined of type I, PERK -/- mouse under cold temperature
Browse structure collections
About this viewer
MolViewer shows 8IBG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.