8IXG: Tubulin alpha-4A chain

GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin seam region. Determined by electron microscopy at 4.4 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 4.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 12
Atoms: 37,368
Mol. weight: 580.92 kDa
Ligands: ATP, G2P, GTP
Released: 16 Aug 2023

Explore 8IXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IXG contains 216 α-helices and 231 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 22 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	58
α-helix	10-28	19
β-strand	30	1	59
β-strand	36	1	59
α-helix	42-45	4
β-strand	51-53	3	60
α-helix	55-57	3
β-strand	59-61	3	60
β-strand	66-67	2	61
α-helix	71-77	7
β-strand	91-92	2	61
α-helix	101-102	2
α-helix	103-107	5
α-helix	113-126	14
β-strand	130-138	9	58
α-helix	143-158	16
β-strand	163-170	8	58
α-helix	181-194	14
β-strand	199-203	5	58
α-helix	204-210	7
α-helix	211-215	5
α-helix	222-236	15
β-strand	246	1	62
α-helix	250-257	8
β-strand	265-266	2	58
β-strand	268-271	4	63
α-helix	276-278	3
α-helix	286-293	8
α-helix	305-307	3
β-strand	310-318	9	63
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	63
β-strand	349-352	4	63
β-strand	353	1	62
β-strand	364-371	8	63
α-helix	372-374	3
α-helix	375-389	15
α-helix	396-399	4
α-helix	405-424	20

Chain B: 18 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	19
α-helix	10-27	18
β-strand	59	1	20
β-strand	69	1	20
β-strand	71-75	5	19
α-helix	78-85	8
β-strand	98-100	3	19
α-helix	111-115	5
α-helix	116-133	18
β-strand	138-144	7	19
α-helix	151-166	16
β-strand	171-178	8	19
α-helix	179-180	2
α-helix	189-203	15
β-strand	206-211	6	19
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	21
α-helix	260-263	4
β-strand	277-279	3	22
α-helix	284-289	6
α-helix	294-301	8
β-strand	318-322	5	23
β-strand	325-327	3	22
α-helix	331-343	13
β-strand	349	1	23
β-strand	357-358	2	23
β-strand	361	1	21
α-helix	375-376	2
β-strand	379-383	5	22
β-strand	384-387	4	23
α-helix	391-407	17
α-helix	412-415	4
α-helix	422-441	20

Chain h: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	31
β-strand	10-15	6	32
α-helix	20-23	4
β-strand	32-34	3	33
β-strand	38-40	3	33
β-strand	45-47	3	33
β-strand	50-52	3	32
α-helix	58-64	7
α-helix	68-75	8
β-strand	78-84	7	32
β-strand	86	1	34
α-helix	91-95	5
β-strand	97	1	35
β-strand	105	1	35
α-helix	107-121	15
β-strand	126-135	10	32
β-strand	144	1	32
β-strand	154-157	4	36
β-strand	163-166	4	36
β-strand	171-172	2	32
α-helix	176-189	14
β-strand	193	1	37
β-strand	201	1	37
β-strand	206-216	11	32
β-strand	222-231	10	32
α-helix	232-234	3
β-strand	235	1	34
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294-302	9	32
α-helix	309-323	15
β-strand	326-327	2	31

Chain H: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
α-helix	10-27	18
β-strand	59	1	2
β-strand	69	1	2
β-strand	71-75	5	1
α-helix	78-86	9
β-strand	98-100	3	1
α-helix	111-115	5
α-helix	116-133	18
β-strand	138-144	7	1
α-helix	151-166	16
β-strand	171-178	8	1
α-helix	179-180	2
α-helix	189-203	15
β-strand	206-211	6	1
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	3
α-helix	260-263	4
β-strand	274-279	6	4
α-helix	284-289	6
α-helix	294-301	8
β-strand	318-322	5	4
β-strand	325-327	3	4
α-helix	331-343	13
β-strand	349	1	4
β-strand	357-358	2	4
β-strand	361	1	3
α-helix	375-376	2
β-strand	379-387	9	4
α-helix	391-407	17
α-helix	412-415	4
α-helix	422-441	20

Chain J: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	38
α-helix	10-27	18
β-strand	59	1	39
β-strand	69	1	39
β-strand	71-75	5	38
α-helix	78-85	8
β-strand	98-100	3	38
α-helix	111-115	5
α-helix	116-133	18
β-strand	138-144	7	38
α-helix	151-166	16
β-strand	171-178	8	38
α-helix	179-180	2
α-helix	189-203	15
β-strand	206-211	6	38
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	40
α-helix	260-263	4
β-strand	274-279	6	41
α-helix	284-289	6
α-helix	294-301	8
β-strand	318-322	5	41
β-strand	325-327	3	41
α-helix	331-343	13
β-strand	349	1	41
β-strand	357-358	2	41
β-strand	361	1	40
α-helix	375-376	2
β-strand	379-387	9	41
α-helix	391-406	16
α-helix	411-415	5
α-helix	422-441	20

Chain K: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	54
α-helix	10-27	18
β-strand	59	1	55
β-strand	69	1	55
β-strand	71-75	5	54
α-helix	78-85	8
β-strand	98-100	3	54
α-helix	111-115	5
α-helix	116-133	18
β-strand	138-144	7	54
α-helix	151-166	16
β-strand	171-178	8	54
α-helix	179-180	2
α-helix	189-203	15
β-strand	206-211	6	54
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	56
α-helix	260-263	4
β-strand	275-279	5	57
α-helix	284-289	6
α-helix	294-301	8
β-strand	318-322	5	57
β-strand	325-327	3	57
α-helix	331-343	13
β-strand	349	1	57
β-strand	357-358	2	57
β-strand	361	1	56
α-helix	375-376	2
β-strand	379-387	9	57
α-helix	391-406	16
α-helix	411-415	5
α-helix	422-441	20

Chain l: 14 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	12
α-helix	9	1
β-strand	10-15	6	13
α-helix	20-23	4
β-strand	32-34	3	14
β-strand	38-40	3	14
β-strand	45-47	3	14
β-strand	50-52	3	13
α-helix	58-64	7
α-helix	68-75	8
β-strand	78-85	8	13
β-strand	86	1	15
α-helix	91-95	5
β-strand	97	1	16
β-strand	105	1	16
α-helix	107-121	15
β-strand	126-135	10	13
β-strand	144	1	13
β-strand	154-157	4	17
β-strand	163-166	4	17
β-strand	171-172	2	13
α-helix	176-189	14
β-strand	193	1	18
β-strand	201	1	18
β-strand	206-216	11	13
β-strand	222-231	10	13
α-helix	232-234	3
β-strand	235	1	15
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294-302	9	13
α-helix	309-323	15
β-strand	326-327	2	12

Chain p: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	47
β-strand	10-14	5	48
α-helix	20-23	4
β-strand	32-34	3	49
β-strand	38-40	3	49
β-strand	45-47	3	49
β-strand	50-52	3	48
α-helix	58-64	7
α-helix	68-75	8
β-strand	78-84	7	48
β-strand	86	1	50
α-helix	91-95	5
β-strand	97	1	51
β-strand	105	1	51
α-helix	107-121	15
β-strand	126-135	10	48
β-strand	144	1	48
β-strand	155-157	3	52
β-strand	163-165	3	52
β-strand	171-172	2	48
α-helix	176-189	14
β-strand	193	1	53
β-strand	201	1	53
β-strand	206-216	11	48
β-strand	222-231	10	48
α-helix	232-234	3
β-strand	235	1	50
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294-301	8	48
α-helix	309-323	15
β-strand	326-327	2	47

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-4A chain	B, H, J, K	protein	454	Mus musculus	P68368 (AlphaFold model)
Tubulin beta-2A chain	R, W, Z, a	protein	457	Mus musculus	Q7TMM9 (AlphaFold model)
Kinesin-1 heavy chain	h, l, p, q	protein	372	Homo sapiens	P33176 (AlphaFold model)

Sequence of entity 1 (B, H, J, K), FASTA

>8IXG_1 Tubulin alpha-4A chain (chains B, H, J, K)
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFTTFFC
ETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEI
IDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPA
PQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQI
VSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNA
CFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVG
INYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME
EGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

Sequence of entity 2 (R, W, Z, a), FASTA

>8IXG_2 Tubulin beta-2A chain (chains R, W, Z, a)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

Sequence of entity 3 (h, l, p, q), FASTA

>8IXG_3 Kinesin-1 heavy chain (chains h, l, p, q)
MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGED
TVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEG
KLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHE
DKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENT
QTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPY
RDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTA
EQWKKKYEKEKE

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	4
G2P	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	4
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	4

Primary citation

Cryo-EM of alpha-tubulin isotype-containing microtubules revealed a contracted structure of alpha 4A/ beta 2A microtubules. Diao, L., Zheng, W., Zhao, Q. et al. Acta Biochim Biophys Sin (Shanghai) (2023) 55:1551-1560. DOI 10.3724/abbs.2023130 · PubMed

Other PDB entries of the same protein (UniProt P68368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IXF 4.4 Å, GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin non-seam region

Browse structure collections

About this viewer

MolViewer shows 8IXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.