Structure of the transmembrane domain of human PD-L2. Determined by solution NMR. Released 13 Mar 2024.
Explore 8J3V in 3D Show helices and sheets RCSB PDB PDBe
8J3V contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 220-250 | 31 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Programmed cell death 1 ligand 2 | A | protein | 60 | Homo sapiens | Q9BQ51 (AlphaFold model) |
>8J3V_1 Programmed cell death 1 ligand 2 (chains A) EPRTHPTWLLHIFIPFSIIAFIFIATVIALRKQLSQKLYSSKDTTKRPVTTTKREVNSAI
Deciphering Cholesterol's Role in PD-L2 Stability: A Distinct Regulatory Mechanism From PD-L1. Zhang, Y., Xiao, T., Wen, M. et al. J Mol Biol (2024) 436:168500-168500. DOI 10.1016/j.jmb.2024.168500 · PubMed
Other PDB entries of the same protein (UniProt Q9BQ51 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8J3V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.