8J6Y: Class A beta-lactamase PSE-4 WT- Apo state

Crystal structure of class A beta-lactamase PSE-4 WT- Apo state. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 May 2024.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Pseudomonas aeruginosa
Chains: 1
Atoms: 2,153
Mol. weight: 32.2 kDa
Released: 1 May 2024

Explore 8J6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J6Y contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	23-35	13
β-strand	39-46	8	1
β-strand	52-55	4	1
β-strand	61-62	2	2
α-helix	64-67	4
α-helix	68-80	13
β-strand	89-91	3	3
α-helix	94-96	3
α-helix	102-105	4
β-strand	111-113	3	3
α-helix	114-124	11
α-helix	127-135	9
α-helix	139-149	11
β-strand	156	1	2
α-helix	163-165	3
β-strand	175-176	2	2
α-helix	178-190	13
α-helix	196-207	12
α-helix	216-219	4
α-helix	220-221	2
β-strand	225-232	8	1
α-helix	234-236	3
β-strand	238-245	8	1
β-strand	252-259	8	1
α-helix	265-282	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactamase PSE-4	A	protein	288	Pseudomonas aeruginosa	P16897 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8J6Y_1 Beta-lactamase PSE-4 (chains A)
MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQR
FPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFA
TMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKA
IASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSI
TAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTSQSR

Primary citation

Crystal structure of class A beta-lactamase PSE-4 WT- Apo state. Sarkar, M., Bhattacharya, S., Hazra, S. To be published.

Other PDB entries of the same protein (UniProt P16897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ID4 1.05 Å, Crystal structure of chimeric beta-lactamase cTEM-17m
4R4S 1.1 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.1 angstrom resolution
4QY6 1.15 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
4R4R 1.2 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.2 angstrom resolution
4QY5 1.5 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
1G6A 1.75 Å, Pse-4 carbenicillinase, R234K mutant
1G68 1.95 Å, Pse-4 carbenicillinase, wild type

Browse structure collections

About this viewer

MolViewer shows 8J6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.