8J8Z: Beta-arrestin1

Structure of beta-arrestin1 in complex with D6Rpp. Determined by electron microscopy at 3.4 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: Rattus norvegicus, Mus musculus, Homo sapiens
Chains: 8
Atoms: 8,722
Mol. weight: 196.78 kDa
Released: 27 Dec 2023

Explore 8J8Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J8Z contains 35 α-helices and 102 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	26-29	4	2
β-strand	34	1	2
α-helix	35-36	2
β-strand	37-42	6	1
α-helix	45-47	3
β-strand	52-63	12	3
β-strand	69	1	4
β-strand	71	1	4
β-strand	75-85	11	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	123-125	3
β-strand	127-129	3	3
α-helix	130-132	3
α-helix	139-140	2
β-strand	141-151	11	3
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-166	4	3
β-strand	169-172	4	2
β-strand	183-190	8	5
β-strand	193-203	11	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	230-242	13	7
β-strand	246-248	3	7
β-strand	251-258	8	7
β-strand	266-274	9	5
β-strand	288-290	3	3
α-helix	291-292	2
β-strand	300	1	3
α-helix	301-303	3
β-strand	317-328	12	7
β-strand	343-349	7	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain B: 13 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	12
β-strand	19-22	4	12
β-strand	26-29	4	13
β-strand	34	1	13
α-helix	35-36	2
β-strand	37-42	6	12
β-strand	53-62	10	14
α-helix	66-68	3
β-strand	76-85	10	14
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	12
α-helix	123-125	3
β-strand	127-129	3	14
α-helix	130-132	3
α-helix	138-140	3
β-strand	141-150	10	14
α-helix	157-158	2
β-strand	159	1	15
β-strand	162	1	15
β-strand	164-168	5	14
β-strand	169-172	4	13
β-strand	183-188	6	16
β-strand	197-203	7	16
β-strand	207-208	2	17
α-helix	213	1
β-strand	214-222	9	16
β-strand	231-241	11	18
β-strand	247	1	18
β-strand	250-258	9	18
β-strand	266-274	9	16
β-strand	288-290	3	14
α-helix	291-292	2
β-strand	300	1	14
α-helix	301-304	4
β-strand	317-327	11	18
β-strand	343-349	7	18
β-strand	350-351	2	17
α-helix	353-356	4

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	8
β-strand	13-14	2	9
β-strand	20-27	8	8
β-strand	35-42	8	9
β-strand	48-55	8	9
β-strand	60-63	4	9
α-helix	65-67	3
β-strand	71-76	6	8
β-strand	81-87	7	8
α-helix	91-93	3
β-strand	95-96	2	9
β-strand	99-103	5	9
β-strand	110-113	4	9
β-strand	118-120	3	9

Chain I: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	19
β-strand	13-14	2	20
β-strand	20-27	8	19
α-helix	32-34	3
β-strand	35-41	7	21
β-strand	49-55	7	21
β-strand	60-63	4	21
α-helix	65-67	3
β-strand	71-76	6	19
β-strand	81-87	7	19
α-helix	91-93	3
β-strand	95-96	2	20
β-strand	98-103	6	21
β-strand	110-113	4	21
β-strand	118-120	3	20

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	10
β-strand	11-13	3	11
β-strand	20-26	7	10
β-strand	34-39	6	11
β-strand	46-50	5	11
β-strand	54-55	2	11
α-helix	56	1
β-strand	63-68	6	10
β-strand	71-76	6	10
β-strand	86-91	6	11
α-helix	97	1
β-strand	98-99	2	11
β-strand	103-106	4	11

Chain M: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	22
β-strand	11-13	3	23
β-strand	20-26	7	22
β-strand	34-39	6	23
β-strand	46-50	5	23
β-strand	54-55	2	23
α-helix	56	1
β-strand	63-68	6	22
β-strand	71-76	6	22
α-helix	81-83	3
β-strand	86-91	6	23
α-helix	97	1
β-strand	98-99	2	23
β-strand	103-106	4	23

Chain U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	348-352	5	12

Chain V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	349-351	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	418	Rattus norvegicus	P29066 (AlphaFold model)
Fab30 Heavy Chain	H, I	protein	237	Mus musculus
Fab30 Light Chain	L, M	protein	215	Mus musculus
Atypical chemokine receptor 2	U, V	protein	18	Homo sapiens	O00590 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8J8Z_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR

Sequence of entity 2 (H, I), FASTA

>8J8Z_2 Fab30 Heavy Chain (chains H, I)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (L, M), FASTA

>8J8Z_3 Fab30 Light Chain (chains L, M)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (U, V), FASTA

>8J8Z_4 Atypical chemokine receptor 2 (chains U, V)
GTAQASLSSCSESSILTA

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor
9DNG 3.52 Å, Structure of rat beta-arrestin 1 by fiducial-assisted cryo-EM

Browse structure collections

About this viewer

MolViewer shows 8J8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.