8JA3: Beta-arrestin1

Structure of beta-arrestin1 in complex with C3aRpp. Determined by electron microscopy at 3.94 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 3.94 Å
Organisms: Rattus norvegicus, Homo sapiens, Mus musculus
Chains: 8
Atoms: 7,130
Mol. weight: 181.01 kDa
Released: 27 Dec 2023

Explore 8JA3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JA3 contains 31 α-helices and 101 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	16
β-strand	19-22	4	16
β-strand	26-28	3	17
β-strand	29	1	18
β-strand	34	1	18
α-helix	35-36	2
β-strand	37-40	4	16
β-strand	53-60	8	19
β-strand	78-84	7	19
α-helix	95-98	4
α-helix	99-108	10
β-strand	114-117	4	16
β-strand	127-129	3	20
β-strand	141	1	20
β-strand	143-150	8	19
α-helix	157-158	2
β-strand	164-168	5	19
β-strand	169-171	3	17
β-strand	184-186	3	21
β-strand	198-202	5	21
β-strand	207-208	2	22
β-strand	214	1	23
β-strand	217-222	6	21
β-strand	228	1	24
β-strand	231-242	12	25
β-strand	246-258	13	25
α-helix	261	1
β-strand	262	1	24
α-helix	263	1
β-strand	266-271	6	21
β-strand	274	1	23
α-helix	279-281	3
β-strand	288-290	3	20
β-strand	300	1	20
α-helix	301-303	3
β-strand	316-327	12	25
α-helix	328-329	2
β-strand	345-349	5	25
β-strand	350-351	2	22
α-helix	353-356	4

Chain B: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	9-12	4	2
β-strand	19-22	4	2
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-37	3
β-strand	38-42	5	2
β-strand	53-60	8	5
β-strand	78-84	7	5
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-116	5	2
β-strand	127-129	3	6
β-strand	141	1	6
β-strand	144-150	7	5
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-168	6	5
β-strand	169-171	3	3
α-helix	178-180	3
β-strand	183-187	5	7
β-strand	197-202	6	7
β-strand	207-208	2	8
α-helix	212-213	2
β-strand	214-222	9	7
β-strand	231-242	12	9
β-strand	246-258	13	9
β-strand	266-274	9	7
α-helix	278-281	4
β-strand	288-290	3	6
α-helix	291-292	2
β-strand	300	1	6
α-helix	301-304	4
β-strand	316-327	12	9
α-helix	328-329	2
β-strand	345-349	5	9
β-strand	350-351	2	8

Chain H: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	26
β-strand	24-28	5	26
α-helix	32-34	3
β-strand	37-42	6	27
β-strand	49-55	7	27
β-strand	60-63	4	27
α-helix	65-67	3
β-strand	75-76	2	26
α-helix	77-79	3
β-strand	81-82	2	26
β-strand	96-101	6	27
β-strand	112-113	2	27

Chain I: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	10
β-strand	20	1	11
β-strand	23-27	5	10
β-strand	36-42	7	12
β-strand	48-55	8	12
β-strand	61-63	3	12
α-helix	65-67	3
β-strand	73-76	4	10
α-helix	77-79	3
β-strand	81-84	4	10
β-strand	87	1	11
α-helix	91-93	3
β-strand	98-102	5	12
β-strand	112-113	2	12

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	28
β-strand	11-12	2	29
β-strand	20-25	6	28
β-strand	35-39	5	30
β-strand	46-50	5	30
β-strand	54-55	2	30
α-helix	56	1
β-strand	63-68	6	28
β-strand	71-76	6	28
β-strand	86-88	3	30
α-helix	97	1
β-strand	103	1	30
β-strand	104-105	2	29

Chain M: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	13
β-strand	11-12	2	14
β-strand	20-26	7	13
β-strand	34-39	6	15
β-strand	46-50	5	15
β-strand	54-55	2	15
α-helix	56	1
β-strand	63-68	6	13
β-strand	71-76	6	13
β-strand	86-91	6	15
β-strand	98-99	2	15
β-strand	104-105	2	14

Chain U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	466	1	1

Chain V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	465-466	2	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	357	Rattus norvegicus	P29066 (AlphaFold model)
C3a anaphylatoxin chemotactic receptor	U, V	protein	10	Homo sapiens	Q16581 (AlphaFold model)
Fab30 heavy chain	H, I	protein	237	Mus musculus
Fab30 light chain	L, M	protein	215	Mus musculus

Sequence of entity 1 (A, B), FASTA

>8JA3_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPK

Sequence of entity 2 (U, V), FASTA

>8JA3_2 C3a anaphylatoxin chemotactic receptor (chains U, V)
SEELTRSTHC

Sequence of entity 3 (H, I), FASTA

>8JA3_3 Fab30 heavy chain (chains H, I)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 4 (L, M), FASTA

>8JA3_4 Fab30 light chain (chains L, M)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor

Browse structure collections

About this viewer

MolViewer shows 8JA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.