8JAQ: CRL2APPBP2
Structure of CRL2APPBP2 bound with RxxGP degron (tetramer). Determined by electron microscopy at 3.26 Å resolution. Released 18 Oct 2023.
- Method
- Electron microscopy
- Resolution
- 3.26 Å
- Organism
- Homo sapiens
- Chains
- 22
- Atoms
- 39,233
- Mol. weight
- 741.46 kDa
- Ligands
- ZN
- Released
- 18 Oct 2023
Explore 8JAQ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8JAQ contains 254 α-helices and 87 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 33 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8 | 1 | 1 |
| α-helix | 10-12 | 3 | |
| α-helix | 13-23 | 11 | |
| α-helix | 26-28 | 3 | |
| α-helix | 32-34 | 3 | |
| α-helix | 37-49 | 13 | |
| α-helix | 53-60 | 8 | |
| α-helix | 63-69 | 7 | |
| α-helix | 77-89 | 13 | |
| α-helix | 93-108 | 16 | |
| α-helix | 113-132 | 20 | |
| α-helix | 136-152 | 17 | |
| α-helix | 156-174 | 19 | |
| α-helix | 179-181 | 3 | |
| α-helix | 182-199 | 18 | |
| α-helix | 206-218 | 13 | |
| α-helix | 222-234 | 13 | |
| α-helix | 242-258 | 17 | |
| α-helix | 262-279 | 18 | |
| α-helix | 285-299 | 15 | |
| α-helix | 308-321 | 14 | |
| α-helix | 327-343 | 17 | |
| α-helix | 351-367 | 17 | |
| α-helix | 374-391 | 18 | |
| α-helix | 396-420 | 25 | |
| α-helix | 426-442 | 17 | |
| α-helix | 445-462 | 18 | |
| α-helix | 468-480 | 13 | |
| α-helix | 481-485 | 5 | |
| α-helix | 488-505 | 18 | |
| α-helix | 513-524 | 12 | |
| α-helix | 530-549 | 20 | |
| α-helix | 556-560 | 5 | |
| α-helix | 567-577 | 11 | |
Chain B: 32 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-12 | 4 | |
| α-helix | 13-23 | 11 | |
| α-helix | 29-32 | 4 | |
| α-helix | 37-49 | 13 | |
| α-helix | 53-60 | 8 | |
| α-helix | 63-70 | 8 | |
| α-helix | 76-89 | 14 | |
| α-helix | 93-108 | 16 | |
| α-helix | 113-133 | 21 | |
| α-helix | 136-151 | 16 | |
| α-helix | 156-174 | 19 | |
| α-helix | 179-198 | 20 | |
| α-helix | 206-218 | 13 | |
| α-helix | 222-233 | 12 | |
| α-helix | 242-258 | 17 | |
| α-helix | 264-275 | 12 | |
| α-helix | 276-280 | 5 | |
| α-helix | 285-300 | 16 | |
| α-helix | 304-321 | 18 | |
| α-helix | 327-343 | 17 | |
| α-helix | 352-367 | 16 | |
| α-helix | 374-391 | 18 | |
| α-helix | 396-420 | 25 | |
| α-helix | 426-441 | 16 | |
| α-helix | 445-462 | 18 | |
| α-helix | 468-480 | 13 | |
| α-helix | 481-485 | 5 | |
| α-helix | 488-505 | 18 | |
| α-helix | 507-509 | 3 | |
| α-helix | 512-524 | 13 | |
| α-helix | 533-550 | 18 | |
| α-helix | 570-576 | 7 | |
Chain C: 5 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-8 | 4 | 2 |
| β-strand | 14-15 | 2 | 2 |
| β-strand | 23 | 1 | 3 |
| α-helix | 24-35 | 12 | |
| β-strand | 43-46 | 4 | 2 |
| β-strand | 49-50 | 2 | 2 |
| α-helix | 51-52 | 2 | |
| β-strand | 56 | 1 | 3 |
| α-helix | 57-59 | 3 | |
| β-strand | 73-78 | 6 | 2 |
| α-helix | 90-92 | 3 | |
| α-helix | 95-98 | 4 | |
Chain D: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 18-22 | 5 | 2 |
| β-strand | 28-32 | 5 | 2 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-46 | 7 | |
| β-strand | 59-61 | 3 | 2 |
| α-helix | 67-82 | 16 | |
| β-strand | 86 | 1 | 1 |
| α-helix | 90-93 | 4 | |
| α-helix | 101-110 | 10 | |
Chain E: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-25 | 16 | |
| α-helix | 32-46 | 15 | |
| α-helix | 54-78 | 25 | |
| α-helix | 83-104 | 22 | |
| α-helix | 106-111 | 6 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 158-172 | 15 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-185 | 8 | |
| α-helix | 187-190 | 4 | |
| α-helix | 201-206 | 6 | |
Chain G: 4 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 4 |
| β-strand | 8-9 | 2 | 5 |
| β-strand | 12-13 | 2 | 5 |
| β-strand | 16-18 | 3 | 4 |
| α-helix | 24-35 | 12 | |
| β-strand | 43 | 1 | 6 |
| α-helix | 46-48 | 3 | |
| α-helix | 72 | 1 | |
| β-strand | 73-75 | 3 | 4 |
| β-strand | 78 | 1 | 6 |
| β-strand | 80-81 | 2 | 7 |
| β-strand | 84-85 | 2 | 7 |
| α-helix | 86-88 | 3 | |
Chain H: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 19 | 1 | 8 |
| β-strand | 20-22 | 3 | 9 |
| β-strand | 28 | 1 | 9 |
| β-strand | 31 | 1 | 8 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-46 | 7 | |
| β-strand | 59-61 | 3 | 9 |
| α-helix | 67-82 | 16 | |
| α-helix | 89-93 | 5 | |
| α-helix | 100-109 | 10 | |
Chain I: 31 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-24 | 15 | |
| α-helix | 32-46 | 15 | |
| α-helix | 54-77 | 24 | |
| α-helix | 83-104 | 22 | |
| α-helix | 106-108 | 3 | |
| α-helix | 109-113 | 5 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 156-171 | 16 | |
| α-helix | 178-190 | 13 | |
| α-helix | 202-206 | 5 | |
| α-helix | 208-229 | 22 | |
| α-helix | 232-253 | 22 | |
| α-helix | 256-258 | 3 | |
| α-helix | 259-268 | 10 | |
| α-helix | 275-280 | 6 | |
| α-helix | 282-287 | 6 | |
| α-helix | 291-303 | 13 | |
| α-helix | 308-326 | 19 | |
| α-helix | 335-356 | 22 | |
| α-helix | 362-376 | 15 | |
| β-strand | 379 | 1 | 10 |
| β-strand | 385 | 1 | 10 |
| α-helix | 387-399 | 13 | |
| α-helix | 408-423 | 16 | |
| α-helix | 428-444 | 17 | |
| α-helix | 451-464 | 14 | |
| α-helix | 471-481 | 11 | |
| α-helix | 483-495 | 13 | |
| β-strand | 508-513 | 6 | 11 |
| α-helix | 531-547 | 17 | |
| β-strand | 551-555 | 5 | 11 |
| β-strand | 561-562 | 2 | 12 |
| β-strand | 574-576 | 3 | 13 |
| β-strand | 577-578 | 2 | 12 |
| α-helix | 579-590 | 12 | |
| β-strand | 593-595 | 3 | 14 |
| α-helix | 596-602 | 7 | |
| α-helix | 610-619 | 10 | |
| β-strand | 623-624 | 2 | 14 |
| β-strand | 637-640 | 4 | 14 |
| β-strand | 650-652 | 3 | 13 |
10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Amyloid protein-binding protein 2 | A, B, J, K | protein | 578 | Homo sapiens | Q92624 (AlphaFold model) |
| Cullin-2 | E, I, L, U | protein | 745 | Homo sapiens | Q13617 (AlphaFold model) |
| Elongin-B | C, G, M, Q | protein | 118 | Homo sapiens | Q15370 (AlphaFold model) |
| Elongin-C | D, H, N, T | protein | 96 | Homo sapiens | Q15369 (AlphaFold model) |
| XP_211896 C-degron | F, O, P, S | protein | 16 | Homo sapiens | |
| E3 ubiquitin-protein ligase RBX1, N-terminally processed | R, V | protein | 108 | Homo sapiens | P62877 |
Sequence of entity 1 (A, B, J, K), FASTA
>8JAQ_1 Amyloid protein-binding protein 2 (chains A, B, J, K)
MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEF
CELEVFAKVLRALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAI
QVGFVLGGFLSDAGWYSDAEKVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYH
LGEETFKLAQTYMDKLSKHGQQANKAALYGELCALLFAKSHYDEAYKWCIEAMKEITAGL
PVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
VDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKFDNALFHAERA
IGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASL
YNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVL
SNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQ
Sequence of entity 2 (E, I, L, U), FASTA
>8JAQ_2 Cullin-2 (chains E, I, L, U)
TSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
Sequence of entity 3 (C, G, M, Q), FASTA
>8JAQ_3 Elongin-B (chains C, G, M, Q)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Sequence of entity 4 (D, H, N, T), FASTA
>8JAQ_4 Elongin-C (chains D, H, N, T)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence of entity 5 (F, O, P, S), FASTA
>8JAQ_5 XP_211896 C-degron (chains F, O, P, S)
TVPTLTRGRLTRNKGP
Sequence of entity 6 (R, V), FASTA
>8JAQ_6 E3 ubiquitin-protein ligase RBX1, N-terminally processed (chains R, V)
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 8 |
Primary citation
Molecular basis for C-degron recognition by CRL2 APPBP2 ubiquitin ligase. Zhao, S., Olmayev-Yaakobov, D., Ru, W. et al. Proc Natl Acad Sci U S A (2023) 120:e2308870120-e2308870120. DOI 10.1073/pnas.2308870120 · PubMed
Other PDB entries of the same protein (UniProt Q92624 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8JAU 3.22 Å, Structure of CRL2APPBP2 bound with the C-degron of MRPL28 (dimer)
- 8JAL 3.3 Å, Structure of CRL2APPBP2 bound with RxxGP degron (dimer)
- 8JAR 3.3 Å, Structure of CRL2APPBP2 bound with RxxGPAA degron (dimer)
- 8JAV 3.44 Å, Structure of CRL2APPBP2 bound with the C-degron of MRPL28 (tetramer)
- 8JAS 3.54 Å, Structure of CRL2APPBP2 bound with RxxGPAA degron (tetramer)
Browse structure collections
About this viewer
MolViewer shows 8JAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.