8JG4: YAF9A YEATS

Crystal Structure of YAF9A YEATS bound to H3K27cr peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 May 2024.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 2,739
Mol. weight: 44.23 kDa
Released: 22 May 2024

Explore 8JG4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JG4 contains 11 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	44-56	13	1
α-helix	58-60	3
β-strand	67-75	9	1
α-helix	81-83	3
β-strand	85-91	7	2
β-strand	100-103	4	2
β-strand	109-114	6	1
β-strand	117	1	3
β-strand	119-126	8	2
α-helix	127	1
β-strand	135-140	6	2
α-helix	157	1
β-strand	158-168	11	1
α-helix	173-179	7
β-strand	186	1	1
α-helix	188-192	5

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	44-56	13	4
α-helix	58-60	3
β-strand	67-75	9	4
α-helix	81-83	3
β-strand	85-91	7	5
β-strand	100-103	4	5
β-strand	109-114	6	4
β-strand	117	1	6
β-strand	119-126	8	5
β-strand	135-140	6	5
α-helix	157	1
β-strand	158-168	11	4
α-helix	173-179	7
β-strand	186	1	4
α-helix	188-191	4

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	28	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14b	A, B	protein	189	Arabidopsis thaliana	Q9FH40 (AlphaFold model)
Histone H3.1	C, D	protein	8	Arabidopsis thaliana	P59226 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8JG4_1 Transcription initiation factor TFIID subunit 14b (chains A, B)
SHMASMTGGQQMGRGSKLKDIEISVPIVYGNVAFWLGKKASEYQSHKWAVYVRGATNEDI
SVVVKKVVFQLHSSFNSPTRVIEEPPFEVSESGWGEFEIAMTLHFHSDVCDKPLSLYHHL
KLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALTFPRLPSGYNLPAPMQ
VEDTGKKKR

Sequence of entity 2 (C, D), FASTA

>8JG4_2 Histone H3.1 (chains C, D)
AARXSAPA

Primary citation

Crystal Structure of YAF9A YEATS bound to H3K27cr peptide. Li, H.T., Liu, W.Q. To be published.

Browse structure collections

About this viewer

MolViewer shows 8JG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.