8JO2: DNA-directed RNA polymerase subunit alpha

Name: PDB 8JO2: Structural basis of transcriptional activation by the OmpR/PhoB-family response regulator PmrA
Published: 2023-08-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structural basis of transcriptional activation by the OmpR/PhoB-family response regulator PmrA. Determined by electron microscopy at 2.74 Å resolution. Released 30 Aug 2023.

Method: Electron microscopy
Resolution: 2.74 Å
Organisms: synthetic construct, Escherichia coli BL21(DE3), Klebsiella pneumoniae JM45
Chains: 10
Atoms: 35,368
Mol. weight: 551 kDa
Released: 30 Aug 2023

Explore 8JO2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JO2 contains 179 α-helices and 242 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-18	7	1
β-strand	24-31	8	1
α-helix	36-49	14
β-strand	52-59	8	2
β-strand	61	1	2
β-strand	74	1	3
α-helix	78-86	9
β-strand	90-92	3	4
β-strand	97-105	9	2
β-strand	108-111	4	3
α-helix	112-114	3
β-strand	115-116	2	2
β-strand	121-123	3	4
β-strand	129-133	5	3
β-strand	139-150	12	2
β-strand	152-153	2	5
α-helix	155-161	7
β-strand	171-172	2	2
β-strand	175-176	2	5
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-232	20

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	6
β-strand	23-31	9	6
α-helix	35-50	16
β-strand	52-61	10	7
β-strand	74	1	8
α-helix	78-86	9
β-strand	90-92	3	9
β-strand	97-105	9	7
β-strand	108-111	4	8
α-helix	112-114	3
β-strand	115-116	2	7
β-strand	121-123	3	9
β-strand	129-133	5	8
β-strand	139-150	12	7
β-strand	153	1	10
α-helix	155-161	7
β-strand	171-172	2	7
β-strand	175	1	10
β-strand	180-189	10	6
β-strand	199-207	9	6
α-helix	213-230	18

Chain C: 53 helices, 95 β-strands

Element	Residues	Length	Sheet
α-helix	11-12	2
β-strand	13-14	2	11
α-helix	19-20	2
α-helix	23-26	4
α-helix	29-39	11
α-helix	49-56	8
β-strand	59-60	2	12
β-strand	66-75	10	12
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-104	12	12
β-strand	116-128	13	12
β-strand	130	1	13
β-strand	136-138	3	13
β-strand	141-145	5	13
α-helix	146	1
β-strand	147-151	5	14
β-strand	154-160	7	15
β-strand	171-177	7	15
β-strand	180	1	16
β-strand	184-187	4	15
β-strand	195-198	4	15
β-strand	204-205	2	15
α-helix	207-211	5
α-helix	217-224	8
β-strand	227-231	5	17
β-strand	238-240	3	17
α-helix	243-246	4
β-strand	250	1	18
β-strand	255-257	3	19
β-strand	260-263	4	19
α-helix	264	1
β-strand	268	1	18
α-helix	271-280	10
β-strand	284-286	3	17
α-helix	291-293	3
β-strand	296	1	20
β-strand	297	1	17
β-strand	301-303	3	21
β-strand	308-311	4	21
β-strand	316	1	20
α-helix	319-327	9
β-strand	332-336	5	17
α-helix	346-353	8
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	16
α-helix	398-407	10
α-helix	422-437	16
β-strand	451-454	4	14
α-helix	456-481	26
α-helix	489-491	3
α-helix	495-508	14
β-strand	512-514	3	13
α-helix	520-526	7
β-strand	529-531	3	14
α-helix	552-554	3
β-strand	558	1	22
β-strand	573-574	2	14
β-strand	575	1	22
β-strand	580-581	2	23
β-strand	587-588	2	23
β-strand	589-595	7	24
β-strand	598-606	9	24
β-strand	615-617	3	24
β-strand	623	1	25
β-strand	629	1	25
β-strand	634-638	5	24
β-strand	641-645	5	24
β-strand	652-653	2	24
β-strand	674	1	26
α-helix	676-685	10
β-strand	700-701	2	11
α-helix	705-710	6
β-strand	716-717	2	27
β-strand	722-727	6	28
β-strand	732-736	5	28
β-strand	748-751	4	28
β-strand	757-758	2	29
β-strand	764-765	2	29
β-strand	768-769	2	27
β-strand	776-777	2	28
β-strand	782-785	4	27
β-strand	789-790	2	30
β-strand	793-794	2	30
β-strand	798-804	7	31
α-helix	812-814	3
β-strand	816-819	4	31
α-helix	821-824	4
β-strand	830-841	12	32
β-strand	842-843	2	33
β-strand	846-847	2	33
β-strand	849-850	2	34
α-helix	859-862	4
β-strand	865	1	35
β-strand	870	1	36
β-strand	871	1	35
α-helix	872	1
β-strand	876-878	3	37
β-strand	882-884	3	36
β-strand	886-889	4	34
α-helix	897-905	9
α-helix	909-911	3
β-strand	913-915	3	34
β-strand	918-919	2	36
α-helix	920-921	2
β-strand	925-927	3	37
β-strand	930-935	6	32
α-helix	943-979	37
α-helix	987-991	5
α-helix	1006-1037	32
α-helix	1042-1043	2
β-strand	1046-1058	13	32
β-strand	1065	1	38
β-strand	1066-1068	3	31
β-strand	1075	1	38
β-strand	1076-1080	5	31
α-helix	1082-1084	3
β-strand	1087	1	39
β-strand	1093	1	39
β-strand	1096-1098	3	31
α-helix	1102-1106	5
β-strand	1108	1	26
α-helix	1110-1133	24
α-helix	1138-1149	12
α-helix	1161-1163	3
α-helix	1166-1176	11
β-strand	1182-1183	2	11
α-helix	1192-1201	10
β-strand	1210	1	40
α-helix	1212	1
β-strand	1213	1	39
α-helix	1214	1
β-strand	1220	1	39
β-strand	1225	1	40
β-strand	1226-1234	9	31
α-helix	1239-1242	4
β-strand	1244	1	41
β-strand	1251	1	42
β-strand	1252	1	43
β-strand	1258	1	42
β-strand	1268-1270	3	44
α-helix	1272-1281	10
α-helix	1284-1291	8
α-helix	1292-1296	5
α-helix	1298-1310	13
α-helix	1321-1331	11
β-strand	1335-1341	7	45

Chain D: 58 helices, 88 β-strands

Element	Residues	Length	Sheet
β-strand	17-24	8	45
α-helix	27-33	7
β-strand	34-37	4	46
β-strand	44	1	47
β-strand	51	1	47
α-helix	52	1
α-helix	59-62	4
β-strand	66	1	48
β-strand	69	1	48
α-helix	78-80	3
β-strand	84	1	49
β-strand	91	1	49
α-helix	95-99	5
β-strand	102-112	11	46
α-helix	114-116	3
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-149	6	50
β-strand	159-160	2	50
α-helix	162-171	10
β-strand	176-179	4	50
α-helix	182-191	10
α-helix	194-207	14
α-helix	211-230	20
α-helix	234-237	4
β-strand	238-244	7	46
α-helix	247-249	3
β-strand	252-254	3	51
β-strand	260-262	3	51
α-helix	264-285	22
α-helix	289-307	19
β-strand	317	1	52
β-strand	323	1	52
α-helix	324	1
α-helix	337-342	6
β-strand	345-347	3	44
β-strand	350-354	5	41
β-strand	355-357	3	53
β-strand	365-369	5	53
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	406-416	11
β-strand	421-424	4	41
α-helix	431-433	3
β-strand	434-437	4	41
β-strand	438-442	5	53
β-strand	447-449	3	53
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	41
α-helix	474-482	9
β-strand	485	1	41
β-strand	491	1	54
β-strand	498	1	54
α-helix	505-513	9
β-strand	526-527	2	55
α-helix	530-539	10
β-strand	547-558	12	55
β-strand	562-573	12	55
α-helix	574-580	7
α-helix	584	1
β-strand	585	1	56
β-strand	586	1	55
β-strand	587	1	56
α-helix	589-591	3
α-helix	598-611	14
α-helix	614-635	22
α-helix	645-647	3
α-helix	651-669	19
α-helix	675-702	28
β-strand	706-709	4	57
β-strand	712-715	4	57
α-helix	721-727	7
α-helix	734-740	7
β-strand	748	1	58
β-strand	754	1	58
α-helix	769-804	36
β-strand	808	1	59
β-strand	809	1	60
β-strand	820-822	3	61
β-strand	825-827	3	62
β-strand	830-833	4	62
α-helix	835-839	5
β-strand	843	1	63
β-strand	844	1	61
β-strand	849	1	64
β-strand	856	1	64
β-strand	863	1	63
α-helix	866-874	9
β-strand	880-882	3	61
α-helix	885-887	3
β-strand	894	1	60
α-helix	896-899	4
β-strand	901-902	2	65
β-strand	907-908	2	65
α-helix	909-910	2
β-strand	914	1	59
α-helix	915-924	10
β-strand	951	1	66
β-strand	956	1	67
β-strand	958-961	4	68
β-strand	967	1	69
β-strand	973	1	69
β-strand	980-984	5	68
β-strand	993-997	5	68
β-strand	1002-1003	2	70
β-strand	1011	1	67
β-strand	1016	1	66
β-strand	1018-1019	2	70
β-strand	1027-1028	2	71
β-strand	1033-1034	2	72
β-strand	1042	1	73
β-strand	1046	1	73
β-strand	1060-1061	2	74
α-helix	1064-1066	3
β-strand	1079	1	75
β-strand	1081	1	72
β-strand	1087	1	72
β-strand	1098	1	75
β-strand	1105-1106	2	74
β-strand	1114-1115	2	72
β-strand	1120-1122	3	71
β-strand	1123	1	74
α-helix	1137-1146	10
β-strand	1156	1	76
β-strand	1161-1165	5	77
β-strand	1172-1178	7	77
β-strand	1187-1191	5	77
β-strand	1202-1204	3	77
β-strand	1209	1	76
α-helix	1214-1216	3
α-helix	1217-1223	7
α-helix	1226-1243	18
α-helix	1250-1260	11
β-strand	1263-1266	4	78
β-strand	1277-1279	3	78
α-helix	1280-1289	10
α-helix	1290-1294	5
β-strand	1302-1304	3	78
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	45
α-helix	1347-1352	6
α-helix	1362-1374	13

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-28	13
α-helix	29-33	5
α-helix	35-37	3
α-helix	46-55	10
α-helix	61-79	19

Chain F: 32 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	81-89	9
α-helix	97-107	11
α-helix	114-136	23
α-helix	138-151	14
α-helix	152-154	3
α-helix	160-164	5
α-helix	214-235	22
α-helix	243-256	14
α-helix	263-288	26
α-helix	289-293	5
α-helix	294-295	2
α-helix	299-308	10
α-helix	314-321	8
α-helix	325-328	4
α-helix	331-333	3
α-helix	334-351	18
α-helix	355-391	37
α-helix	401-418	18
α-helix	421-423	3
α-helix	427-445	19
α-helix	451-453	3
α-helix	454-474	21
α-helix	477-479	3
α-helix	480-487	8
α-helix	491-500	10
β-strand	505-506	2	51
α-helix	519-521	3
β-strand	524	1	43
α-helix	529-530	2
α-helix	538-549	12
α-helix	553-563	11
α-helix	573-579	7
α-helix	586-597	12
α-helix	606-611	6

Chain H: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	79
α-helix	10-23	14
β-strand	27-30	4	79
α-helix	33-42	10
β-strand	47-50	4	79
α-helix	59-68	10
β-strand	75-79	5	79
α-helix	84-93	10
β-strand	97-100	4	79
α-helix	105-120	16
β-strand	126-129	4	80
β-strand	132-135	4	80
β-strand	140-143	4	80
β-strand	146-147	2	80
α-helix	152-163	12
β-strand	169	1	81
α-helix	171-178	8
α-helix	190-201	12
β-strand	206-208	3	81
β-strand	214-216	3	81

Chain I: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	82
α-helix	10-22	13
β-strand	27-30	4	82
α-helix	33-42	10
β-strand	47-50	4	82
α-helix	59-68	10
β-strand	75-79	5	82
α-helix	84-93	10
β-strand	97-100	4	82
α-helix	105-119	15
β-strand	127-129	3	83
β-strand	132-135	4	83
α-helix	136-138	3
β-strand	140-143	4	83
β-strand	146-148	3	83
α-helix	152-163	12
α-helix	167-168	2
β-strand	169	1	84
α-helix	170	1
α-helix	171-178	8
α-helix	189-201	13
β-strand	206-208	3	84
β-strand	214-216	3	84

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (65-mer)	1	DNA	65	synthetic construct
DNA (65-mer)	2	DNA	65	synthetic construct
DNA-directed RNA polymerase subunit alpha	A, B	protein	329	Escherichia coli BL21(DE3)	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	C	protein	1342	Escherichia coli BL21(DE3)	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	D	protein	1407	Escherichia coli BL21(DE3)	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	E	protein	91	Escherichia coli BL21(DE3)	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	F	protein	613	Escherichia coli BL21(DE3)	P00579
DNA-binding transcriptional regulator BasR	H, I	protein	226	Klebsiella pneumoniae JM45	A0A0R4I965

Sequence of entity 1 (1), FASTA

>8JO2_1 DNA (65-MER) (chains 1)
AGAAATATTAATTTCTTAATATTATCCTAAGCAAGGTCGTATAATGTGTGCAGTCTGACG
CGGCG

Sequence of entity 2 (2), FASTA

>8JO2_2 DNA (65-MER) (chains 2)
CGCCGCGTCAGACTCGTAGGATTATACGACCTTGCTTAGGATAATATTAAGAAATTAATA
TTTCT

Sequence of entity 3 (A, B), FASTA

>8JO2_3 DNA-directed RNA polymerase subunit alpha (chains A, B)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 4 (C), FASTA

>8JO2_4 DNA-directed RNA polymerase subunit beta (chains C)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 5 (D), FASTA

>8JO2_5 DNA-directed RNA polymerase subunit beta' (chains D)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 6 (E), FASTA

>8JO2_6 DNA-directed RNA polymerase subunit omega (chains E)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 7 (F), FASTA

>8JO2_7 RNA polymerase sigma factor RpoD (chains F)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 8 (H, I), FASTA

>8JO2_8 DNA-binding transcriptional regulator BasR (chains H, I)
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGL
HFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHN
NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYS
GDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANNDDTEHLE

Primary citation

Structural basis of transcriptional activation by the OmpR/PhoB-family response regulator PmrA. Lou, Y.C., Huang, H.Y., Yeh, H.H. et al. Nucleic Acids Res (2023) 51:10049-10058. DOI 10.1093/nar/gkad724 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 8JO2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.