8JRU: Glucagon receptor

Cryo-EM structure of the glucagon receptor bound to beta-arrestin 1 in ligand-free state. Determined by electron microscopy at 3.5 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Influenza A virus (strain A/Victoria/3/1975 H3N2), Homo sapiens, Bos taurus
Chains: 5
Atoms: 7,120
Mol. weight: 276.44 kDa
Ligands: PIO
Released: 16 Aug 2023

Explore 8JRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JRU contains 26 α-helices and 67 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	12	1	2
β-strand	18-21	4	2
β-strand	22	1	1
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-36	2
β-strand	37	1	5
β-strand	40-43	4	2
α-helix	48-50	3
β-strand	53-63	11	6
β-strand	75-85	11	6
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-114	3	2
β-strand	117	1	5
α-helix	119-120	2
β-strand	127-129	3	6
α-helix	130-131	2
α-helix	139-140	2
β-strand	141-150	10	6
α-helix	160-162	3
β-strand	163-168	6	6
β-strand	169-171	3	3
α-helix	180-182	3
β-strand	183-186	4	7
β-strand	198-203	6	7
β-strand	207-209	3	8
β-strand	214-222	9	7
β-strand	228-240	13	9
β-strand	248-258	11	9
β-strand	262	1	9
β-strand	266-274	9	7
β-strand	288-290	3	6
α-helix	302-305	4
β-strand	319-329	11	9
β-strand	342-349	8	9
β-strand	350-352	3	8

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	15
β-strand	11-12	2	16
β-strand	17	1	17
β-strand	20-25	6	15
β-strand	34	1	18
β-strand	38	1	19
β-strand	46	1	19
β-strand	49-51	3	18
β-strand	57-59	3	18
α-helix	61-63	3
β-strand	67-72	6	15
β-strand	77-82	6	15
β-strand	83	1	17
β-strand	92-93	2	19
β-strand	97	1	18
α-helix	103-104	2
β-strand	108-109	2	19
β-strand	111-112	2	16

Chain H: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	10
β-strand	20-28	9	10
β-strand	37-42	6	11
β-strand	48-55	8	11
β-strand	60-63	4	11
β-strand	71-76	6	10
β-strand	81-87	7	10
β-strand	95-101	7	11
β-strand	112	1	11
β-strand	117-119	3	11

Chain L: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	12
β-strand	11-13	3	13
β-strand	20-26	7	12
β-strand	34-38	5	14
β-strand	46-49	4	14
β-strand	63-66	4	12
β-strand	71-76	6	12
α-helix	81-83	3
β-strand	86-87	2	13
β-strand	88-91	4	14
β-strand	99	1	14
β-strand	103-106	4	13

Chain R: 13 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	140-164	25
α-helix	172-200	29
α-helix	221-253	33
α-helix	261-272	12
α-helix	274-284	11
α-helix	301-303	3
α-helix	308-334	27
α-helix	344-366	23
α-helix	381-384	4
α-helix	386-390	5
α-helix	392-397	6
α-helix	398-402	5
α-helix	405-423	19
β-strand	1361-1364	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HA signal peptide,HPC4 purification tag,Glucagon receptor,C-terminal tail of Vasopressin V2 receptor	R	protein	478	Influenza A virus (strain A/Victoria/3/1975 H3N2), Homo sapiens	P03435, P04070 (AlphaFold model), P30518 (AlphaFold model), P47871 (AlphaFold model)
Beta-arrestin 1 and single-chain fragment variable 30 (scFv30)	A, H, L	protein	627	Bos taurus	P17870
Nanobody 32	B	protein	126	Escherichia phage EcSzw-2

Sequence of entity 1 (R), FASTA

>8JRU_1 HA signal peptide,HPC4 purification tag,Glucagon receptor,C-terminal tail of Vasopressin V2 receptor (chains R)
GSMKTIIALSYIFCLVFAGAPEDQVDPRLIDGKGSGSAGSAGSQVMDFLFEKWKLYGDQC
HHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPD
GQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAIL
GGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAG
CRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWA
VVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDY
KFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFL
NKEVQSELRRRWHRWRLGKVLWEERNTSNARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 2 (A, H, L), FASTA

>8JRU_2 Beta-arrestin 1 and single-chain fragment variable 30 (scFv30) (chains A, H, L)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKA
PKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTK
VEIKGTTAASGSSGGSSSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQA
PGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSR
QFWYSGLDYWGQGTLVTVSSAHHHHHH

Sequence of entity 3 (B), FASTA

>8JRU_3 Nanobody 32 (chains B)
MAQVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTT
YADSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHH
HHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1

Primary citation

Tail engagement of arrestin at the glucagon receptor. Chen, K., Zhang, C., Lin, S. et al. Nature (2023) 620:904-910. DOI 10.1038/s41586-023-06420-x · PubMed

Other PDB entries of the same protein (UniProt P03435), best resolution first:

6R0E 1.91 Å, Structure of F11TCR in complex with DR1 MHC Class II presenting PKYVKQNTLKLAT
8IOD 2.59 Å, Cryo-EM structure of the PG-901-bound human melanocortin receptor 5 (MC5R)-Gs complex
8INR 2.73 Å, Cryo-EM structure of the alpha-MSH-bound human melanocortin receptor 5 (MC5R)-Gs complex
4O58 2.75 Å, Crystal structure of broadly neutralizing antibody F045-092 in complex with…
8IOC 2.86 Å, Cryo-EM structure of the gamma-MSH-bound human melanocortin receptor 3 (MC3R)-Gs complex
4GMS 2.95 Å, Crystal structure of heterosubtypic Fab S139/1 in complex with influenza A H3…
8JRV 3.3 Å, Cryo-EM structure of the glucagon receptor bound to glucagon and beta-arrestin 1

Browse structure collections

About this viewer

MolViewer shows 8JRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.