Untethered R0RBR. Determined by X-ray diffraction at 2.9 Å resolution. Released 3 Jul 2024.
Explore 8JWV in 3D Show helices and sheets RCSB PDB PDBe
8JWV contains 9 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 147-150 | 4 | 1 |
| β-strand | 156-159 | 4 | 1 |
| β-strand | 160-166 | 7 | 2 |
| β-strand | 174-176 | 3 | 3 |
| α-helix | 183-187 | 5 | |
| β-strand | 193 | 1 | 4 |
| β-strand | 194-196 | 3 | 3 |
| β-strand | 205 | 1 | 4 |
| β-strand | 206-212 | 7 | 2 |
| β-strand | 223 | 1 | 2 |
| β-strand | 224-225 | 2 | 1 |
| β-strand | 229-230 | 2 | 5 |
| α-helix | 236 | 1 | |
| β-strand | 237 | 1 | 6 |
| α-helix | 238 | 1 | |
| β-strand | 244 | 1 | 6 |
| β-strand | 248-250 | 3 | 5 |
| β-strand | 257 | 1 | 7 |
| β-strand | 258-260 | 3 | 5 |
| α-helix | 261-273 | 13 | |
| β-strand | 278-280 | 3 | 8 |
| β-strand | 284-286 | 3 | 8 |
| α-helix | 301-307 | 7 | |
| α-helix | 308-326 | 19 | |
| β-strand | 330-331 | 2 | 9 |
| β-strand | 340-341 | 2 | 9 |
| β-strand | 349-351 | 3 | 10 |
| β-strand | 363-365 | 3 | 10 |
| β-strand | 371 | 1 | 10 |
| α-helix | 372-373 | 2 | |
| α-helix | 395-400 | 6 | |
| β-strand | 402 | 1 | 7 |
| β-strand | 415-417 | 3 | 11 |
| β-strand | 424-426 | 3 | 11 |
| β-strand | 431 | 1 | 12 |
| β-strand | 433-435 | 3 | 13 |
| β-strand | 444-446 | 3 | 13 |
| β-strand | 451-452 | 2 | 13 |
| α-helix | 455-461 | 7 | |
| β-strand | 463 | 1 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase parkin | A | protein | 325 | Homo sapiens | O60260 (AlphaFold model) |
>8JWV_1 E3 ubiquitin-protein ligase parkin (chains A) SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPH CPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVIC LDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGA EECVLQMGGVLCPRPGCGAGLLPEPDCRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAV FENLYFQSQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQ CRLEWCWNCGCEWNRVCMGDHWFDV
Water and common crystallization additives (GOL) are not listed.
Additional feedforward mechanism of Parkin activation via binding of phospho-UBL and RING0 in trans. Lenka, D.R., Dahe, S.V., Antico, O. et al. Elife (2024) 13. DOI 10.7554/eLife.96699 · PubMed
Other PDB entries of the same protein (UniProt O60260 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8JWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.