NMR structure of human leptin. Determined by solution NMR. Released 7 Feb 2024.
Explore 8K6Z in 3D Show helices and sheets RCSB PDB PDBe
8K6Z contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-25 | 23 | |
| α-helix | 51-65 | 15 | |
| α-helix | 71-93 | 23 | |
| α-helix | 107-114 | 8 | |
| α-helix | 122-137 | 16 | |
| α-helix | 139-142 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leptin | A | protein | 146 | Homo sapiens | P41159 (AlphaFold model) |
>8K6Z_1 Leptin (chains A) VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYS TEVVALSRLQGSLQDMLWQLDLSPGC
The solution structure of human leptin reveals a conformational plasticity important for receptor recognition. Fan, X., Qin, R., Yuan, W. et al. Structure (2024) 32:18-23.e2. DOI 10.1016/j.str.2023.10.009 · PubMed
Other PDB entries of the same protein (UniProt P41159 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8K6Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.