8K6Z: Human leptin

NMR structure of human leptin. Determined by solution NMR. Released 7 Feb 2024.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,123
Mol. weight: 16.04 kDa
Released: 7 Feb 2024

Explore 8K6Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8K6Z contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-25	23
α-helix	51-65	15
α-helix	71-93	23
α-helix	107-114	8
α-helix	122-137	16
α-helix	139-142	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leptin	A	protein	146	Homo sapiens	P41159 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8K6Z_1 Leptin (chains A)
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV
YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYS
TEVVALSRLQGSLQDMLWQLDLSPGC

Primary citation

The solution structure of human leptin reveals a conformational plasticity important for receptor recognition. Fan, X., Qin, R., Yuan, W. et al. Structure (2024) 32:18-23.e2. DOI 10.1016/j.str.2023.10.009 · PubMed

Other PDB entries of the same protein (UniProt P41159 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AX8 2.4 Å, Human obesity protein, leptin
9PUO 3.1 Å, Neutralizing monoclonal antibody Fab fragment bound to leptin
8X85 3.58 Å, Structure of leptin-LepR dimer
7Z3Q 3.62 Å, Crystal structure of the human leptin:LepR-CRH2 encounter complex to 3.6 A resolution.
8X81 3.77 Å, Structure of leptin-LepR trimer with a large gap
8X80 3.88 Å, Structure of leptin-LepR trimer with a small gap
8AVE 5.62 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…
8AVF 6.45 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…
8AVO 6.84 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…

Browse structure collections

About this viewer

MolViewer shows 8K6Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.