8KIG: MC3R

Cryo-EM structure of MC3R in complex with SHU9119. Determined by electron microscopy at 3.1 Å resolution. Released 26 Feb 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Escherichia coli, Homo sapiens, Pyrococcus abyssi GE5
Chains: 2
Atoms: 2,104
Mol. weight: 70.15 kDa
Ligands: CA
Released: 26 Feb 2025

Explore 8KIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8KIG contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	42-65	24
α-helix	76-102	27
α-helix	111-120	10
α-helix	126-147	22
α-helix	152-155	4
α-helix	158-181	24
α-helix	187-210	24
α-helix	237-240	4
α-helix	243-264	22
α-helix	272-278	7
α-helix	281-283	3
α-helix	286-290	5
α-helix	295-300	6
α-helix	304-314	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,Melanocortin receptor 3,GlgA glycogen synthase,Fusion protein	R	protein	619	Escherichia coli, Homo sapiens, Pyrococcus abyssi GE5, synthetic construct	P41968 (AlphaFold model)
SHU9119	L	protein	9	synthetic construct

Sequence of entity 1 (R), FASTA

>8KIG_1 Soluble cytochrome b562,Melanocortin receptor 3,GlgA glycogen synthase,Fusion protein (chains R)
DYKDDDDKGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLLVPR
GSNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILV
ILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNI
FDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVF
IVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFAGIDCSFWNESYLTGSRDERKKSLLS
KFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARS
LEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGG
LRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSSCMKGAVTI
TILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSL
ELRNTFREILCGCNGMNLG

Sequence of entity 2 (L), FASTA

>8KIG_2 SHU9119 (chains L)
XLDHXRWKX

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure basis of ligand selectivity and signal transduction in human melanocortin-3 receptor. Jingpeng, F., Hongli, H. To be published.

Other PDB entries of the same protein (UniProt P41968 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9K3F 2.75 Å, Cryo-EM structure of the unliganded human melanocortin receptor 3 (MC3R)-Gs complex
8IOC 2.86 Å, Cryo-EM structure of the gamma-MSH-bound human melanocortin receptor 3 (MC3R)-Gs complex
8W8W 2.9 Å, Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex
8W8X 2.9 Å, Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex
8W8Y 2.9 Å, Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex

Browse structure collections

About this viewer

MolViewer shows 8KIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.