8P1H: PDB entry 8P1H

Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic loop fragment of the alpha7 acetylcholine receptor. Determined by X-ray diffraction at 1.95 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,214
Mol. weight: 56.24 kDa
Ligands: AZI, BEZ
Released: 18 Oct 2023

Explore 8P1H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P1H contains 29 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-67	30
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-132	21
α-helix	135-137	3
α-helix	138-159	22
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-200	16
α-helix	203-205	3
α-helix	211-228	18

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-67	30
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-132	21
α-helix	135-159	25
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-200	16
α-helix	203-205	3
α-helix	211-228	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta,Neuronal acetylcholine…	A, B	protein	248	Homo sapiens	P36544 (AlphaFold model), P63104 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8P1H_1 Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta,Neuronal acetylcholine receptor subunit alpha-7 (chains A, B)
GPHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
AWRVVSSIEQKTEGAAAAQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGGGGQRRC
SLASVEMS

Ligands and cofactors

ID	Name	Formula	Copies
AZI	Azide ion	N3	3
BEZ	Benzoic acid	C7 H6 O2	1

Water and common crystallization additives (PEG, EDO) are not listed.

Primary citation

Crystal structure reveals canonical recognition of the phosphorylated cytoplasmic loop of human alpha7 nicotinic acetylcholine receptor by 14-3-3 protein. Sluchanko, N.N., Kapitonova, A.A., Shulepko, M.A. et al. Biochem Biophys Res Commun (2023) 682:91-96. DOI 10.1016/j.bbrc.2023.09.086 · PubMed

Other PDB entries of the same protein (UniProt P36544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AFN 2.15 Å, alpha7-AChBP in complex with lobeline and fragment 5
9QTO 2.16 Å, Human alpha7 nicotinic receptor in complex with the E6 nanobody
8V8A 2.19 Å, Alpha7-nicotinic acetylcholine receptor time resolved bound to epibatidine and…
5AFJ 2.2 Å, alpha7-AChBP in complex with lobeline and fragment 1
9QTN 2.28 Å, Human alpha7 nicotinic receptor in complex with the F1 nanobody
8C9X 2.3 Å, human alpha7 nicotinic receptor in complex with the C4 nanobody
8UT1 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine
8UTB 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and NS-1738
8UZJ 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and ivermectin
8V88 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and GAT107
8V80 2.34 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and (-)-TQS
5AFK 2.38 Å, alpha7-AChBP in complex with lobeline and fragment 2

Browse structure collections

About this viewer

MolViewer shows 8P1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.