8P4B: DNA-directed RNA polymerase II subunit RPB1
Structural insights into human co-transcriptional capping - structure 2. Determined by electron microscopy at 3.2 Å resolution. Released 16 Aug 2023.
- Method
- Electron microscopy
- Resolution
- 3.2 Å
- Organisms
- Sus scrofa, unidentified, Homo sapiens
- Chains
- 16
- Atoms
- 35,383
- Mol. weight
- 611.92 kDa
- Ligands
- MG, ZN
- Released
- 16 Aug 2023
Explore 8P4B in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8P4B contains 185 α-helices and 246 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 72 helices, 68 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15 | 1 | 1 |
| β-strand | 20-22 | 3 | 2 |
| β-strand | 25 | 1 | 3 |
| α-helix | 26-27 | 2 | |
| α-helix | 28-34 | 7 | |
| β-strand | 43 | 1 | 4 |
| β-strand | 47 | 1 | 5 |
| β-strand | 52 | 1 | 5 |
| β-strand | 56 | 1 | 4 |
| β-strand | 86-94 | 9 | 6 |
| α-helix | 100-109 | 10 | |
| α-helix | 124-132 | 9 | |
| α-helix | 137-148 | 12 | |
| β-strand | 190-194 | 5 | 7 |
| β-strand | 197-201 | 5 | 7 |
| β-strand | 214-215 | 2 | 7 |
| α-helix | 218-226 | 9 | |
| α-helix | 230-236 | 7 | |
| α-helix | 245-247 | 3 | |
| β-strand | 250-255 | 6 | 6 |
| α-helix | 256 | 1 | |
| β-strand | 264 | 1 | 8 |
| β-strand | 272 | 1 | 8 |
| α-helix | 275-296 | 22 | |
| α-helix | 302-318 | 17 | |
| α-helix | 326-328 | 3 | |
| β-strand | 329 | 1 | 9 |
| α-helix | 331-333 | 3 | |
| α-helix | 334 | 1 | |
| β-strand | 335 | 1 | 9 |
| α-helix | 336 | 1 | |
| α-helix | 339-342 | 4 | |
| α-helix | 349-353 | 5 | |
| β-strand | 357-358 | 2 | 10 |
| β-strand | 362-369 | 8 | 11 |
| β-strand | 377-380 | 4 | 11 |
| α-helix | 382-385 | 4 | |
| β-strand | 389-393 | 5 | 12 |
| α-helix | 394 | 1 | |
| α-helix | 399-408 | 10 | |
| β-strand | 416-420 | 5 | 12 |
| β-strand | 426-428 | 3 | 12 |
| β-strand | 445-449 | 5 | 12 |
| α-helix | 450 | 1 | |
| β-strand | 455-459 | 5 | 11 |
| β-strand | 469-476 | 8 | 11 |
| β-strand | 482-484 | 3 | 11 |
| α-helix | 486-488 | 3 | |
| α-helix | 489-492 | 4 | |
| β-strand | 500-504 | 5 | 11 |
| α-helix | 509-518 | 10 | |
| β-strand | 520 | 1 | 11 |
| α-helix | 521-524 | 4 | |
| β-strand | 526 | 1 | 13 |
| β-strand | 533 | 1 | 13 |
| α-helix | 541-548 | 8 | |
| β-strand | 554-555 | 2 | 14 |
| α-helix | 557-564 | 8 | |
| α-helix | 574 | 1 | |
| β-strand | 575 | 1 | 15 |
| α-helix | 576-577 | 2 | |
| β-strand | 579-581 | 3 | 16 |
| β-strand | 585 | 1 | 16 |
| β-strand | 586-587 | 2 | 14 |
| α-helix | 588-595 | 8 | |
| β-strand | 602-603 | 2 | 17 |
| α-helix | 612-615 | 4 | |
| β-strand | 629-630 | 2 | 17 |
| β-strand | 635-637 | 3 | 17 |
| α-helix | 642-645 | 4 | |
| α-helix | 652-659 | 8 | |
| α-helix | 662-683 | 22 | |
| β-strand | 686 | 1 | 18 |
| α-helix | 689-692 | 4 | |
| α-helix | 697-721 | 25 | |
| α-helix | 725-728 | 4 | |
| α-helix | 733-759 | 27 | |
| α-helix | 765-770 | 6 | |
| α-helix | 778-781 | 4 | |
| α-helix | 782-786 | 5 | |
| β-strand | 789-790 | 2 | 19 |
| β-strand | 793 | 1 | 20 |
| β-strand | 796 | 1 | 20 |
| β-strand | 822-823 | 2 | 19 |
| α-helix | 833-868 | 36 | |
| β-strand | 872-873 | 2 | 21 |
| β-strand | 879-880 | 2 | 21 |
| β-strand | 886-888 | 3 | 21 |
| α-helix | 891-893 | 3 | |
| β-strand | 896 | 1 | 22 |
| β-strand | 902-905 | 4 | 23 |
| α-helix | 913-920 | 8 | |
| α-helix | 927-931 | 5 | |
| β-strand | 934 | 1 | 24 |
| α-helix | 936-944 | 9 | |
| α-helix | 946-969 | 24 | |
| β-strand | 976-979 | 4 | 23 |
| α-helix | 983-993 | 11 | |
| β-strand | 1002 | 1 | 24 |
| α-helix | 1006-1019 | 14 | |
| α-helix | 1028-1037 | 10 | |
| α-helix | 1039-1048 | 10 | |
| α-helix | 1051-1053 | 3 | |
| α-helix | 1054-1058 | 5 | |
| α-helix | 1062-1077 | 16 | |
| β-strand | 1080 | 1 | 22 |
| α-helix | 1081-1082 | 2 | |
| α-helix | 1087-1096 | 10 | |
| α-helix | 1098-1100 | 3 | |
| α-helix | 1121-1128 | 8 | |
| β-strand | 1140-1142 | 3 | 25 |
| β-strand | 1143 | 1 | 26 |
| α-helix | 1146-1149 | 4 | |
| α-helix | 1151-1161 | 11 | |
| β-strand | 1164 | 1 | 27 |
| α-helix | 1166-1169 | 4 | |
| β-strand | 1170-1177 | 8 | 28 |
| α-helix | 1189-1194 | 6 | |
| β-strand | 1210-1216 | 7 | 28 |
| α-helix | 1218-1224 | 7 | |
| α-helix | 1228-1239 | 12 | |
| β-strand | 1245-1247 | 3 | 28 |
| β-strand | 1256-1259 | 4 | 28 |
| α-helix | 1283-1294 | 12 | |
| β-strand | 1299 | 1 | 27 |
| β-strand | 1307-1310 | 4 | 25 |
| β-strand | 1319 | 1 | 29 |
| β-strand | 1331 | 1 | 29 |
| β-strand | 1335-1338 | 4 | 25 |
| β-strand | 1352 | 1 | 26 |
| α-helix | 1362-1368 | 7 | |
| α-helix | 1371-1388 | 18 | |
| α-helix | 1395-1404 | 10 | |
| α-helix | 1426-1429 | 4 | |
| α-helix | 1437-1445 | 9 | |
| β-strand | 1448-1449 | 2 | 2 |
| α-helix | 1455-1459 | 5 | |
| β-strand | 1472-1475 | 4 | 30 |
| α-helix | 1477-1480 | 4 | |
| β-strand | 1484 | 1 | 31 |
Chain B: 52 helices, 78 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-36 | 15 | |
| α-helix | 41-49 | 9 | |
| α-helix | 50-54 | 5 | |
| α-helix | 55-61 | 7 | |
| α-helix | 63-64 | 2 | |
| β-strand | 84 | 1 | 32 |
| β-strand | 87-93 | 7 | 32 |
| β-strand | 97-98 | 2 | 33 |
| β-strand | 106-107 | 2 | 33 |
| α-helix | 108-109 | 2 | |
| α-helix | 110-116 | 7 | |
| β-strand | 121-133 | 13 | 32 |
| β-strand | 139-153 | 15 | 32 |
| β-strand | 155 | 1 | 34 |
| α-helix | 168-173 | 6 | |
| β-strand | 185-187 | 3 | 34 |
| β-strand | 190-193 | 4 | 34 |
| β-strand | 196-200 | 5 | 35 |
| α-helix | 201 | 1 | |
| β-strand | 206-208 | 3 | 36 |
| β-strand | 215-223 | 9 | 36 |
| β-strand | 233-240 | 8 | 36 |
| β-strand | 256-259 | 4 | 36 |
| β-strand | 263 | 1 | 37 |
| β-strand | 266-268 | 3 | 36 |
| α-helix | 269-276 | 8 | |
| α-helix | 282-286 | 5 | |
| α-helix | 295-305 | 11 | |
| α-helix | 306-308 | 3 | |
| α-helix | 314-323 | 10 | |
| β-strand | 325 | 1 | 37 |
| α-helix | 332-341 | 10 | |
| α-helix | 342-346 | 5 | |
| α-helix | 358-377 | 20 | |
| α-helix | 382-384 | 3 | |
| β-strand | 391-394 | 4 | 35 |
| α-helix | 396-423 | 28 | |
| α-helix | 431-434 | 4 | |
| α-helix | 437-450 | 14 | |
| β-strand | 453 | 1 | 38 |
| β-strand | 463 | 1 | 38 |
| β-strand | 468-469 | 2 | 34 |
| α-helix | 470 | 1 | |
| α-helix | 475-482 | 8 | |
| β-strand | 484-486 | 3 | 35 |
| α-helix | 503-505 | 3 | |
| β-strand | 523-525 | 3 | 35 |
| β-strand | 531-532 | 2 | 39 |
| α-helix | 539-545 | 7 | |
| β-strand | 551-552 | 2 | 40 |
| β-strand | 565-569 | 5 | 40 |
| β-strand | 572-577 | 6 | 40 |
| α-helix | 584-593 | 10 | |
| β-strand | 602-605 | 4 | 40 |
| β-strand | 612-615 | 4 | 40 |
| β-strand | 621-627 | 7 | 39 |
| β-strand | 628 | 1 | 41 |
| β-strand | 633 | 1 | 41 |
| α-helix | 637-644 | 8 | |
| α-helix | 653-658 | 6 | |
| β-strand | 662-666 | 5 | 39 |
| α-helix | 667-671 | 5 | |
| β-strand | 675-676 | 2 | 39 |
| α-helix | 679-682 | 4 | |
| β-strand | 695-696 | 2 | 39 |
| α-helix | 700-703 | 4 | |
| α-helix | 708-710 | 3 | |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 42 |
| α-helix | 719-728 | 10 | |
| β-strand | 732 | 1 | 43 |
| β-strand | 748-751 | 4 | 44 |
| β-strand | 755 | 1 | 45 |
| β-strand | 759-760 | 2 | 46 |
| α-helix | 764-767 | 4 | |
| β-strand | 776-782 | 7 | 47 |
| β-strand | 783 | 1 | 18 |
| β-strand | 794-797 | 4 | 47 |
| α-helix | 798-803 | 6 | |
| β-strand | 808-817 | 10 | 44 |
| β-strand | 827-829 | 3 | 48 |
| β-strand | 837 | 1 | 48 |
| β-strand | 853 | 1 | 49 |
| α-helix | 854-855 | 2 | |
| β-strand | 859 | 1 | 44 |
| β-strand | 865-867 | 3 | 49 |
| β-strand | 869-872 | 4 | 48 |
| β-strand | 889-891 | 3 | 48 |
| α-helix | 893 | 1 | |
| β-strand | 894-895 | 2 | 49 |
| α-helix | 896-897 | 2 | |
| β-strand | 903-911 | 9 | 44 |
| β-strand | 917-927 | 11 | 44 |
| β-strand | 934-936 | 3 | 50 |
| β-strand | 942-944 | 3 | 50 |
| β-strand | 945-949 | 5 | 47 |
| β-strand | 956 | 1 | 51 |
| β-strand | 965-967 | 3 | 47 |
| α-helix | 969-971 | 3 | |
| α-helix | 972-975 | 4 | |
| β-strand | 977 | 1 | 42 |
| α-helix | 978-993 | 16 | |
| α-helix | 996 | 1 | |
| β-strand | 997-998 | 2 | 46 |
| α-helix | 1008-1016 | 9 | |
| β-strand | 1025-1026 | 2 | 47 |
| β-strand | 1029 | 1 | 51 |
| α-helix | 1035 | 1 | |
| β-strand | 1036 | 1 | 51 |
| α-helix | 1037 | 1 | |
| α-helix | 1040 | 1 | |
| β-strand | 1041-1048 | 8 | 47 |
| β-strand | 1049-1050 | 2 | 50 |
| β-strand | 1051 | 1 | 43 |
| β-strand | 1060 | 1 | 11 |
| β-strand | 1067 | 1 | 52 |
| β-strand | 1074 | 1 | 52 |
| α-helix | 1075 | 1 | |
| β-strand | 1085-1086 | 2 | 10 |
| α-helix | 1088-1097 | 10 | |
| α-helix | 1100-1104 | 5 | |
| α-helix | 1105-1109 | 5 | |
| β-strand | 1113-1119 | 7 | 1 |
| β-strand | 1125 | 1 | 1 |
| β-strand | 1127-1129 | 3 | 53 |
| β-strand | 1134-1136 | 3 | 53 |
| β-strand | 1146-1152 | 7 | 1 |
| α-helix | 1153-1164 | 12 | |
| β-strand | 1167 | 1 | 3 |
| β-strand | 1170-1172 | 3 | 2 |
Chain C: 10 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-14 | 7 | 54 |
| β-strand | 18-24 | 7 | 54 |
| α-helix | 28-40 | 13 | |
| β-strand | 44-55 | 12 | 55 |
| α-helix | 61-69 | 9 | |
| β-strand | 74 | 1 | 56 |
| α-helix | 78-81 | 4 | |
| β-strand | 99-106 | 8 | 55 |
| α-helix | 112 | 1 | |
| β-strand | 113-116 | 4 | 57 |
| α-helix | 117-119 | 3 | |
| β-strand | 121-122 | 2 | 55 |
| β-strand | 128 | 1 | 56 |
| β-strand | 149-153 | 5 | 57 |
| β-strand | 158-168 | 11 | 55 |
| α-helix | 174-176 | 3 | |
| β-strand | 179-186 | 8 | 54 |
| α-helix | 200-202 | 3 | |
| α-helix | 204-206 | 3 | |
| α-helix | 218-220 | 3 | |
| β-strand | 229-235 | 7 | 54 |
| α-helix | 241-270 | 30 | |
Chain D: 9 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29 | 1 | |
| β-strand | 30-31 | 2 | 30 |
| α-helix | 34-49 | 16 | |
| α-helix | 55-58 | 4 | |
| α-helix | 59-70 | 12 | |
| α-helix | 77-89 | 13 | |
| α-helix | 94-103 | 10 | |
| α-helix | 108-114 | 7 | |
| α-helix | 116-118 | 3 | |
| α-helix | 124-137 | 14 | |
Chain E: 12 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-24 | 21 | |
| β-strand | 26-27 | 2 | 58 |
| α-helix | 30-33 | 4 | |
| α-helix | 37-44 | 8 | |
| β-strand | 61-64 | 4 | 58 |
| β-strand | 71-75 | 5 | 58 |
| α-helix | 85-96 | 12 | |
| β-strand | 101-106 | 6 | 58 |
| α-helix | 109-111 | 3 | |
| α-helix | 112-120 | 9 | |
| β-strand | 128-131 | 4 | 58 |
| α-helix | 134-136 | 3 | |
| α-helix | 139-141 | 3 | |
| β-strand | 147-150 | 4 | 59 |
| α-helix | 151-152 | 2 | |
| α-helix | 153-163 | 11 | |
| α-helix | 167-169 | 3 | |
| β-strand | 172-173 | 2 | 60 |
| α-helix | 178-183 | 6 | |
| β-strand | 191-196 | 6 | 59 |
| β-strand | 202-207 | 6 | 59 |
| β-strand | 208-209 | 2 | 60 |
Chain F: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 56-57 | 2 | 61 |
| α-helix | 59-74 | 16 | |
| α-helix | 77-78 | 2 | |
| β-strand | 79 | 1 | 31 |
| α-helix | 89-99 | 11 | |
| β-strand | 104-109 | 6 | 30 |
| β-strand | 115-119 | 5 | 30 |
| β-strand | 124-125 | 2 | 61 |
Chain G: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-13 | 12 | 30 |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 38-39 | 2 | 30 |
| β-strand | 43-54 | 12 | 30 |
| α-helix | 56-57 | 2 | |
| β-strand | 58-59 | 2 | 30 |
| α-helix | 60 | 1 | |
| β-strand | 66-77 | 12 | 30 |
| β-strand | 83-92 | 10 | 69 |
| β-strand | 96-101 | 6 | 69 |
| β-strand | 104-109 | 6 | 69 |
| β-strand | 118-120 | 3 | 70 |
| β-strand | 127-129 | 3 | 70 |
| β-strand | 136-137 | 2 | 70 |
| β-strand | 142-153 | 12 | 69 |
| β-strand | 156-162 | 7 | 69 |
| β-strand | 170 | 1 | 69 |
Chain H: 0 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-14 | 9 | 62 |
| β-strand | 25-32 | 8 | 62 |
| β-strand | 38-44 | 7 | 62 |
| β-strand | 55-61 | 7 | 62 |
| β-strand | 65 | 1 | 63 |
| β-strand | 74 | 1 | 15 |
| β-strand | 83 | 1 | 63 |
| β-strand | 90 | 1 | 62 |
| β-strand | 91-92 | 2 | 16 |
| β-strand | 93-101 | 9 | 62 |
| β-strand | 112-118 | 7 | 62 |
| β-strand | 121-126 | 6 | 62 |
| β-strand | 139-142 | 4 | 62 |
| β-strand | 145-148 | 4 | 62 |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase II subunit RPB1 | A | protein | 1970 | Sus scrofa | P11414 (AlphaFold model) |
| DNA-directed RNA polymerase subunit beta | B | protein | 1174 | Sus scrofa | I3LGP4 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB3 | C | protein | 275 | Sus scrofa | I3LCH3 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit E | E | protein | 210 | Sus scrofa | I3LSI7 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit F | F | protein | 127 | Sus scrofa | A0A4X1VEK9 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 150 | Sus scrofa | I3LCB2 |
| DNA-directed RNA polymerase II subunit RPB9 | I | protein | 125 | Sus scrofa | P60899 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC5 | J | protein | 67 | Sus scrofa | A0A8W4F9W9 |
| DNA-directed RNA polymerase II subunit RPB11-a | K | protein | 117 | Sus scrofa | F1RKE4 |
| RNA polymerase II subunit K | L | protein | 58 | Sus scrofa | A0A4X1TRS6 |
| DNA (5'-d(p*ap*gp*cp*gp*gp*cp*gp*gp*ap*gp*cp*cp*ap*gp*cp*ap*gp*gp*gp*ap*gp*cp*tp*g)-3') | N | DNA | 24 | unidentified | |
| RNA (5'-r(p*gp*up*ap*ap*cp*cp*gp*gp*ap*gp*ap*gp*gp*gp*ap*ap*cp*cp*cp*ap*cp*u)-3') | P | RNA | 22 | unidentified | |
4 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>8P4B_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
Sequence of entity 2 (B), FASTA
>8P4B_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
Sequence of entity 3 (C), FASTA
>8P4B_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
Sequence of entity 4 (E), FASTA
>8P4B_4 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Sequence of entity 5 (F), FASTA
>8P4B_5 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD
Sequence of entity 6 (H), FASTA
>8P4B_6 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sequence of entity 7 (I), FASTA
>8P4B_7 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
Sequence of entity 8 (J), FASTA
>8P4B_8 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
Sequence of entity 9 (K), FASTA
>8P4B_9 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Sequence of entity 10 (L), FASTA
>8P4B_10 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Sequence of entity 11 (N), FASTA
>8P4B_11 DNA (5'-D(P*AP*GP*CP*GP*GP*CP*GP*GP*AP*GP*CP*CP*AP*GP*CP*AP*GP*GP*GP*AP*GP*CP*TP*G)-3') (chains N)
AGCGGCGGAGCCAGCAGGGAGCTG
Sequence of entity 12 (P), FASTA
>8P4B_12 RNA (5'-R(P*GP*UP*AP*AP*CP*CP*GP*GP*AP*GP*AP*GP*GP*GP*AP*AP*CP*CP*CP*AP*CP*U)-3') (chains P)
GUAACCGGAGAGGGAACCCACU
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 8 |
Primary citation
Structural insights into human co-transcriptional capping. Garg, G., Dienemann, C., Farnung, L. et al. Mol Cell (2023) 83:2464-2477.e5. DOI 10.1016/j.molcel.2023.06.002 · PubMed
Other PDB entries of the same protein (UniProt P11414 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
- 8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
- 8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
- 7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
- 7OPD 3.0 Å, Pol II-CSB-CRL4CSA-UVSSA-SPT6-PAF (Structure 5)
- 8OEU 3.04 Å, Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
- 8OF0 3.05 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, Structure 1
- 7B0Y 3.6 Å, Structure of a transcribing RNA polymerase II-U1 snRNP complex
- 8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
- 8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
- 8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
- 8P4F 4.0 Å, Structural insights into human co-transcriptional capping - structure 6
Browse structure collections
About this viewer
MolViewer shows 8P4B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.