Alpha-1-antitrypsin - Sydney variant (G192C). Determined by X-ray diffraction at 1.91 Å resolution. Released 3 Apr 2024.
Explore 8P4J in 3D Show helices and sheets RCSB PDB PDBe
8P4J contains 13 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-44 | 18 | |
| β-strand | 50-52 | 3 | 1 |
| α-helix | 54-65 | 12 | |
| α-helix | 70-79 | 10 | |
| α-helix | 89-103 | 15 | |
| β-strand | 112-121 | 10 | 2 |
| β-strand | 126 | 1 | 3 |
| α-helix | 128-132 | 5 | |
| α-helix | 133-137 | 5 | |
| β-strand | 141-145 | 5 | 2 |
| α-helix | 150-164 | 15 | |
| β-strand | 182-191 | 10 | 2 |
| β-strand | 194 | 1 | 1 |
| α-helix | 197-199 | 3 | |
| α-helix | 200-202 | 3 | |
| β-strand | 204-211 | 8 | 4 |
| β-strand | 214-227 | 14 | 4 |
| β-strand | 228-232 | 5 | 1 |
| β-strand | 237-244 | 8 | 1 |
| β-strand | 248-255 | 8 | 1 |
| α-helix | 260-266 | 7 | |
| α-helix | 269-277 | 9 | |
| β-strand | 282-289 | 8 | 4 |
| β-strand | 291-298 | 8 | 2 |
| α-helix | 299-304 | 6 | |
| α-helix | 310-312 | 3 | |
| β-strand | 322 | 1 | 3 |
| β-strand | 331-340 | 10 | 2 |
| β-strand | 363-365 | 3 | 4 |
| β-strand | 370-376 | 7 | 1 |
| β-strand | 382-388 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-1-antitrypsin | A | protein | 400 | Homo sapiens | P01009 (AlphaFold model) |
>8P4J_1 Alpha-1-antitrypsin (chains A) HHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSP VSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTT GNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVK ELDRDTVFALVNYIFFKCKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKK LSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSIT GTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLE AIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
A novel pathological mutant reveals the role of torsional flexibility in the serpin breach in adoption of an aggregation-prone intermediate. Kamuda, K., Ronzoni, R., Majumdar, A. et al. FEBS J (2024) 291:2937-2954. DOI 10.1111/febs.17121 · PubMed
Other PDB entries of the same protein (UniProt P01009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8P4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.