Structural characterization of PHOX2B and its DNA interactions shed lights into the molecular basis of the + 7Ala variant pathogenicity in CCHS. Determined by solution NMR. Released 15 May 2024.
Explore 8P7G in 3D Show helices and sheets RCSB PDB PDBe
8P7G contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 12-24 | 13 | |
| α-helix | 30-40 | 11 | |
| α-helix | 44-61 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Paired mesoderm homeobox protein 2B | A | protein | 63 | Homo sapiens | Q99453 (AlphaFold model) |
>8P7G_1 Paired mesoderm homeobox protein 2B (chains A) ASQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK QER
Structural characterization of PHOX2B and its DNA interaction shed light on the molecular basis of the +7Ala variant pathogenicity in CCHS. Diana, D., Pirone, L., Russo, L. et al. Chem Sci (2024) 15:8858-8872. DOI 10.1039/d3sc06427a · PubMed
Other PDB entries of the same protein (UniProt Q99453 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8P7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.