8PIV: Glutamate receptor

Homomeric GluA2 flip R/G-unedited Q/R-edited F231A mutant in tandem with TARP gamma-2, desensitized conformation 1. Determined by electron microscopy at 3.46 Å resolution. Released 30 Aug 2023.

Method: Electron microscopy
Resolution: 3.46 Å
Organism: Rattus norvegicus
Chains: 8
Atoms: 18,089
Mol. weight: 546.49 kDa
Ligands: POV, OLC, PLM
Released: 30 Aug 2023

Explore 8PIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PIV contains 109 α-helices and 112 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	394	1
β-strand	395-399	5	1
β-strand	402	1	2
β-strand	406	1	2
β-strand	407-408	2	3
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	3
α-helix	424-436	13
β-strand	440-444	5	1
β-strand	453	1	4
β-strand	460	1	4
α-helix	462-468	7
β-strand	474-475	2	1
β-strand	480	1	5
α-helix	483-486	4
β-strand	489-491	3	1
β-strand	496-498	3	5
β-strand	500-503	4	6
α-helix	511-513	3
α-helix	516-518	3
β-strand	521	1	7
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-628	33
α-helix	636-640	5
β-strand	646-648	3	6
β-strand	650	1	8
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	8
α-helix	686-695	10
β-strand	700-705	6	6
α-helix	706-713	8
β-strand	722-723	2	6
β-strand	730-732	3	5
β-strand	735-737	3	1
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
β-strand	787	1	9
α-helix	788	1
α-helix	789-791	3
α-helix	793-819	27

Chain B: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	394	1
β-strand	395-399	5	10
β-strand	402	1	11
β-strand	406	1	11
β-strand	407-408	2	12
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	12
α-helix	424-436	13
β-strand	440-444	5	10
β-strand	453	1	13
β-strand	460	1	13
α-helix	462-468	7
β-strand	474-475	2	10
β-strand	480	1	14
α-helix	483-486	4
β-strand	489-491	3	10
α-helix	492	1
α-helix	494	1
β-strand	496-498	3	14
β-strand	500-505	6	15
α-helix	511-513	3
α-helix	516-518	3
β-strand	521	1	16
α-helix	523-545	23
α-helix	573-584	12
α-helix	596-624	29
β-strand	646-648	3	15
β-strand	650	1	17
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	17
α-helix	686-695	10
β-strand	700-705	6	15
α-helix	706-713	8
β-strand	720-723	4	15
β-strand	730-732	3	14
β-strand	735-737	3	10
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
α-helix	785-786	2
β-strand	787	1	7
α-helix	788	1
α-helix	793-822	30

Chain C: 21 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	394	1
β-strand	395-399	5	18
β-strand	402	1	19
β-strand	406	1	19
β-strand	407-408	2	20
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	20
α-helix	424-436	13
β-strand	440-444	5	18
β-strand	453	1	21
β-strand	460	1	21
α-helix	462-468	7
β-strand	474-475	2	18
β-strand	480	1	22
α-helix	483-486	4
β-strand	489-491	3	18
β-strand	496-498	3	22
β-strand	500-505	6	23
α-helix	511-513	3
α-helix	516-518	3
β-strand	521	1	24
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-625	30
α-helix	636-640	5
β-strand	646-648	3	23
β-strand	650	1	25
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	25
α-helix	686-695	10
β-strand	700-705	6	23
α-helix	706-713	8
β-strand	720-723	4	23
β-strand	730-732	3	22
β-strand	735-737	3	18
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
β-strand	787	1	16
α-helix	793-820	28

Chain D: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	394	1
β-strand	395-399	5	26
β-strand	402	1	27
β-strand	406	1	27
β-strand	407-408	2	28
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	28
α-helix	424-436	13
β-strand	440-444	5	26
β-strand	453	1	29
β-strand	460	1	29
α-helix	462-468	7
β-strand	474-475	2	26
β-strand	480	1	30
α-helix	483-486	4
β-strand	489-491	3	26
β-strand	496-498	3	30
β-strand	500-501	2	31
α-helix	511-513	3
α-helix	516-518	3
β-strand	521	1	9
α-helix	523-544	22
α-helix	573-584	12
α-helix	596-625	30
β-strand	646-648	3	32
β-strand	650	1	33
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	33
α-helix	686-695	10
β-strand	700-702	3	32
β-strand	704-705	2	31
α-helix	712-714	3
β-strand	730-732	3	30
β-strand	735-737	3	26
α-helix	743-755	13
α-helix	758-764	7
α-helix	765-769	5
α-helix	786	1
β-strand	787	1	24
α-helix	788	1
α-helix	789-791	3
α-helix	793-822	30

Chain E: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-29	22
β-strand	34-38	5	34
β-strand	57-61	5	34
β-strand	67-68	2	34
α-helix	93-103	11
α-helix	106-124	19
α-helix	134-159	26
β-strand	176	1	34
α-helix	178-209	32

Chain F: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-27	22
β-strand	34	1	35
β-strand	37-38	2	36
β-strand	57-58	2	36
β-strand	59	1	37
β-strand	65-67	3	38
β-strand	68	1	37
β-strand	77-79	3	38
α-helix	93-103	11
α-helix	106-126	21
α-helix	134-159	26
β-strand	176	1	35
α-helix	178-208	31

Chain G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8-29	22
β-strand	34-38	5	39
β-strand	57-61	5	39
β-strand	65-68	4	39
β-strand	77-79	3	39
α-helix	93-103	11
α-helix	106-126	21
α-helix	134-161	28
β-strand	174-176	3	39
α-helix	178-209	32

Chain H: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6-29	24
β-strand	34	1	40
β-strand	36-38	3	41
β-strand	57-59	3	41
β-strand	65-67	3	42
β-strand	68	1	41
β-strand	77-79	3	42
α-helix	94-103	10
α-helix	106-123	18
α-helix	134-160	27
β-strand	176	1	40
α-helix	178-209	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor	A, B, C, D	protein	883	Rattus norvegicus	G3V914 (AlphaFold model)
Voltage-dependent calcium channel gamma-2 subunit	E, F, G, H	protein	323	Rattus norvegicus	Q71RJ2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8PIV_1 Glutamate receptor (chains A, B, C, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI

Sequence of entity 2 (E, F, G, H), FASTA

>8PIV_2 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLTATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	5
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	4
PLM	Palmitic acid	C16 H32 O2	7

Primary citation

Structural mobility tunes signalling of the GluA1 AMPA glutamate receptor. Zhang, D., Ivica, J., Krieger, J.M. et al. Nature (2023) 621:877-882. DOI 10.1038/s41586-023-06528-0 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8PIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.