HpARI bound to mouse IL-33. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 May 2024.
Explore 8Q5R in 3D Show helices and sheets RCSB PDB PDBe
8Q5R contains 16 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 112-115 | 4 | |
| β-strand | 116-125 | 10 | 1 |
| β-strand | 130-136 | 7 | 1 |
| β-strand | 139-145 | 7 | 1 |
| β-strand | 156-163 | 8 | 1 |
| β-strand | 178-185 | 8 | 1 |
| β-strand | 191-196 | 6 | 1 |
| β-strand | 201-206 | 6 | 1 |
| α-helix | 212-215 | 4 | |
| β-strand | 217-221 | 5 | 1 |
| α-helix | 223-225 | 3 | |
| β-strand | 227-230 | 4 | 1 |
| β-strand | 237-242 | 6 | 1 |
| β-strand | 245-250 | 6 | 1 |
| α-helix | 256-259 | 4 | |
| β-strand | 261-264 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 65 | 1 | 2 |
| α-helix | 68-72 | 5 | |
| α-helix | 77-79 | 3 | |
| α-helix | 84-85 | 2 | |
| β-strand | 87-91 | 5 | 1 |
| α-helix | 92-93 | 2 | |
| β-strand | 100 | 1 | 2 |
| β-strand | 106 | 1 | 2 |
| β-strand | 111 | 1 | 2 |
| β-strand | 116-120 | 5 | 1 |
| β-strand | 127 | 1 | 3 |
| β-strand | 130 | 1 | 4 |
| β-strand | 133-136 | 4 | 1 |
| β-strand | 139-141 | 3 | 1 |
| α-helix | 143 | 1 | |
| β-strand | 144 | 1 | 4 |
| α-helix | 145 | 1 | |
| β-strand | 146 | 1 | 3 |
| α-helix | 147-150 | 4 | |
| β-strand | 151-152 | 2 | 5 |
| α-helix | 153-159 | 7 | |
| β-strand | 164-167 | 4 | 6 |
| α-helix | 171-174 | 4 | |
| α-helix | 176-178 | 3 | |
| α-helix | 179-182 | 4 | |
| β-strand | 186-187 | 2 | 1 |
| β-strand | 194-195 | 2 | 5 |
| β-strand | 200-204 | 5 | 6 |
| β-strand | 217-223 | 7 | 6 |
| β-strand | 226-228 | 3 | 6 |
| α-helix | 233-236 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-33 | A | protein | 158 | Mus musculus | Q8BVZ5 (AlphaFold model) |
| Alarmin release inhibitor | B | protein | 237 | Heligmosomoides bakeri | A0A3P7XL18 (AlphaFold model) |
>8Q5R_1 Interleukin-33 (chains A) SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPAS QSGDGVDGKKVMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVS FECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
>8Q5R_2 Alarmin release inhibitor (chains B) AGQRCRFTDVERDKGYTGMLLKGRLRKTAGNGRTVELICGRGNHQYTCESGVLKESSPRQ ARCGCKGILEMLFDMPKEERPSPMYDSVTYDPTPNTPTTVGKDGIWNGVDYRQGSTVKPY CDTGPVIQGSSKAVCVSGKWVPTLGVCPKMCSIGSLKENGKFVDVTATTKGDELNPPPRE QTLIPIVRKVDKDKVQHGVKVVALCKAEDSTTAAEGVQEFECDNGKWKPEPVPCPEP
Structural basis for IL-33 recognition and its antagonism by the helminth effector protein HpARI2. Jamwal, A., Colomb, F., McSorley, H.J. et al. Nat Commun (2024) 15:5226-5226. DOI 10.1038/s41467-024-49550-0 · PubMed
Other PDB entries of the same protein (UniProt Q8BVZ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Q5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.