Anaerobic crystal structure of apo-HIF prolyl hydroxylase 2 (PHD2 181-407)in complex with acetate (ACT) and HIF2alpha-CODD peptide. Determined by X-ray diffraction at 1.49 Å resolution. Released 21 Aug 2024.
Explore 8Q5S in 3D Show helices and sheets RCSB PDB PDBe
8Q5S contains 12 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-192 | 3 | |
| α-helix | 193-198 | 6 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 240 | 1 | 2 |
| α-helix | 248-250 | 3 | |
| β-strand | 252 | 1 | 3 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-282 | 16 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-304 | 7 | 1 |
| β-strand | 308-313 | 6 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 362-367 | 6 | 1 |
| β-strand | 374-379 | 6 | 3 |
| β-strand | 382-392 | 11 | 1 |
| α-helix | 393-404 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 526-529 | 4 | |
| β-strand | 531 | 1 | 2 |
| α-helix | 532 | 1 | |
| α-helix | 538-539 | 2 | |
| β-strand | 540-541 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 233 | Homo sapiens | Q9GZT9 (AlphaFold model) |
| Endothelial PAS domain-containing protein 1 | B | protein | 20 | Homo sapiens | Q99814 (AlphaFold model) |
>8Q5S_1 Egl nine homolog 1 (chains A) GSHMASPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING RTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFA DIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGE
>8Q5S_2 Endothelial PAS domain-containing protein 1 (chains B) ELDLETLAPYIPMDGEDFQL
HIF prolyl hydroxylase 2 in complex with HIF2alpha-CODD. Fiorini, G., Figg Jr, W.D., Schofield, C.J. To be published.
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Q5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.