Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478). Determined by X-ray diffraction at 1.76 Å resolution. Released 28 Aug 2024.
Explore 8Q7O in 3D Show helices and sheets RCSB PDB PDBe
8Q7O contains 26 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 46-52 | 7 | 2 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 2 |
| β-strand | 104-109 | 6 | 2 |
| β-strand | 113-118 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 3 |
| β-strand | 10-13 | 4 | 4 |
| β-strand | 18-25 | 8 | 3 |
| β-strand | 33-39 | 7 | 4 |
| β-strand | 46-52 | 7 | 4 |
| β-strand | 57-59 | 3 | 4 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 3 |
| β-strand | 77-82 | 6 | 3 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 4 |
| β-strand | 104-109 | 6 | 4 |
| β-strand | 113-118 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 5 |
| α-helix | 34-36 | 3 | |
| β-strand | 43-45 | 3 | 5 |
| α-helix | 48-50 | 3 | |
| α-helix | 53-62 | 10 | |
| α-helix | 63-65 | 3 | |
| α-helix | 66-71 | 6 | |
| α-helix | 77-85 | 9 | |
| α-helix | 87-89 | 3 | |
| α-helix | 91-93 | 3 | |
| α-helix | 100-116 | 17 | |
| α-helix | 123-125 | 3 | |
| α-helix | 127-129 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-30 | 5 | 6 |
| α-helix | 34-36 | 3 | |
| β-strand | 43-47 | 5 | 6 |
| α-helix | 51-62 | 12 | |
| α-helix | 63-65 | 3 | |
| α-helix | 66-71 | 6 | |
| α-helix | 77-85 | 9 | |
| α-helix | 87-89 | 3 | |
| α-helix | 91-93 | 3 | |
| α-helix | 100-116 | 17 | |
| α-helix | 123-125 | 3 | |
| α-helix | 127-129 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nanobody 14478 | A, B | protein | 124 | Lama glama | |
| Frizzled-3 | C, D | protein | 124 | Homo sapiens | Q9NPG1 (AlphaFold model) |
>8Q7O_1 Nanobody 14478 (chains A, B) ETGQVQLVESGGGLVQAGGSLRLSCAASGSISSINAMGWYRQAPGKQRELVAAITSGGST NYADSVKGRFTISRDNAKNTVYLQMNSLKPGDTAVYYCNLLYYIDYVEYDYWGQGTQVTV SSGT
>8Q7O_2 Frizzled-3 (chains C, D) ETGFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLC ALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPGTLE VLFQ
Water and common crystallization additives (SO4, GOL, DMS) are not listed.
Structural insights into Frizzled3 through nanobody modulators. Hillier, J., Zhao, Y., Carrique, L. et al. Nat Commun (2024) 15:7228-7228. DOI 10.1038/s41467-024-51451-1 · PubMed
Other PDB entries of the same protein (UniProt Q9NPG1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Q7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.