8QRY: Yeast spindle body component Spc98

Crystal structure of the yeast spindle body component Spc98. Determined by X-ray diffraction at 1.87 Å resolution. Released 3 Apr 2024.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 806
Mol. weight: 10.83 kDa
Released: 3 Apr 2024

Explore 8QRY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QRY contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	21-35	15
α-helix	45-53	9
α-helix	60-76	17
α-helix	82-92	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spindle pole body component	A	protein	96	Saccharomyces cerevisiae	P53540 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8QRY_1 Spindle pole body component (chains A)
AMELEPTLFGIIEALAPQLLSQSHLQTFVSDVVNLLRSSTKSATQLGPLIDFYKLQSLDS
PETTIMWHKIEKFLDALFGIQNTDDMVKYLSVFQSL

Primary citation

Structure of the native gamma-tubulin ring complex capping spindle microtubules. Dendooven, T., Yatskevich, S., Burt, A. et al. Nat Struct Mol Biol (2024) 31:1134-1144. DOI 10.1038/s41594-024-01281-y · PubMed

Other PDB entries of the same protein (UniProt P53540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M2W 3.0 Å, Engineered disulfide cross-linked closed conformation of the Yeast gamma-TuRC(SS)
7M2X 3.6 Å, Open conformation of the Yeast wild-type gamma-TuRC
7M2Z 3.7 Å, Monomeric single-particle reconstruction of the Yeast gamma-TuSC
7M2Y 4.03 Å, Closed conformation of the Yeast wild-type gamma-TuRC
5FLZ 6.9 Å, Cryo-EM structure of gamma-TuSC oligomers in a closed conformation
5FM1 8.0 Å, Structure of gamma-tubulin small complex based on a cryo-EM map, chemical cross-links,…
8QV3 8.2 Å, Structure of the y-Tubulin Small Complex (yTuSC) as part of the native y-Tubulin Ring…
8QV2 9.2 Å, Structure of the native y-Tubulin Ring Complex (yTuRC) capping microtubule minus ends at…
9A15 Integrative structure of the yeast gammaTuSC-Spc110 monomer complex
9A16 Integrative structure of the yeast gammaTuSC-Spc110 dimer complex
9A17 Integrative structure of the yeast gammaTuSC-Spc110 tetramer complex

Browse structure collections

About this viewer

MolViewer shows 8QRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.