8QYL: Proteasome subunit alpha type-2
Human 20S proteasome assembly intermediate structure 2. Determined by electron microscopy at 2.67 Å resolution. Released 21 Feb 2024.
- Method
- Electron microscopy
- Resolution
- 2.67 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 20,997
- Mol. weight
- 331.98 kDa
- Released
- 21 Feb 2024
Explore 8QYL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8QYL contains 111 α-helices and 144 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-30 | 11 | |
| β-strand | 35-40 | 6 | 1 |
| β-strand | 43-49 | 7 | 1 |
| β-strand | 57 | 1 | 2 |
| β-strand | 66-69 | 4 | 3 |
| β-strand | 72-78 | 7 | 3 |
| α-helix | 80-101 | 22 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| β-strand | 124 | 1 | 4 |
| β-strand | 127 | 1 | 5 |
| β-strand | 132-139 | 8 | 3 |
| β-strand | 144-149 | 6 | 3 |
| β-strand | 155-157 | 3 | 3 |
| β-strand | 158 | 1 | 6 |
| β-strand | 160-163 | 4 | 1 |
| α-helix | 167-177 | 11 | |
| α-helix | 184-196 | 13 | |
| β-strand | 208-214 | 7 | 1 |
| β-strand | 217-220 | 4 | 1 |
| α-helix | 223-231 | 9 | |
Chain B: 8 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-25 | 7 | |
| α-helix | 26-28 | 3 | |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 42-48 | 7 | 7 |
| β-strand | 56 | 1 | 6 |
| β-strand | 65-67 | 3 | 8 |
| β-strand | 72-78 | 7 | 8 |
| α-helix | 80-101 | 22 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-123 | 17 | |
| β-strand | 124 | 1 | 9 |
| β-strand | 127 | 1 | 4 |
| β-strand | 132-140 | 9 | 8 |
| β-strand | 144-150 | 7 | 8 |
| β-strand | 156-158 | 3 | 8 |
| β-strand | 159 | 1 | 10 |
| β-strand | 161-164 | 4 | 7 |
| α-helix | 168-178 | 11 | |
| α-helix | 186-200 | 15 | |
| β-strand | 211-218 | 8 | 7 |
| β-strand | 223-227 | 5 | 7 |
| α-helix | 230-248 | 19 | |
Chain C: 9 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-26 | 10 | |
| β-strand | 32-36 | 5 | 11 |
| β-strand | 40-46 | 7 | 11 |
| β-strand | 54 | 1 | 10 |
| α-helix | 56-59 | 4 | |
| β-strand | 62-66 | 5 | 12 |
| β-strand | 69-75 | 7 | 12 |
| α-helix | 77-97 | 21 | |
| α-helix | 101-103 | 3 | |
| α-helix | 104-117 | 14 | |
| β-strand | 124 | 1 | 9 |
| β-strand | 129-136 | 8 | 12 |
| β-strand | 142-147 | 6 | 12 |
| β-strand | 153-155 | 3 | 12 |
| β-strand | 156 | 1 | 13 |
| β-strand | 158-161 | 4 | 11 |
| α-helix | 165-175 | 11 | |
| α-helix | 184-195 | 12 | |
| β-strand | 206-212 | 7 | 11 |
| β-strand | 218-219 | 2 | 11 |
| α-helix | 220-221 | 2 | |
| α-helix | 222-240 | 19 | |
Chain D: 9 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-29 | 8 | |
| α-helix | 30-33 | 4 | |
| β-strand | 37-41 | 5 | 14 |
| β-strand | 46-51 | 6 | 14 |
| β-strand | 59 | 1 | 13 |
| β-strand | 70 | 1 | 15 |
| β-strand | 74-80 | 7 | 15 |
| α-helix | 82-84 | 3 | |
| α-helix | 86-103 | 18 | |
| α-helix | 106-108 | 3 | |
| α-helix | 109-120 | 12 | |
| β-strand | 139-147 | 9 | 15 |
| β-strand | 150-156 | 7 | 15 |
| β-strand | 162-165 | 4 | 15 |
| β-strand | 167-170 | 4 | 14 |
| α-helix | 175-184 | 10 | |
| α-helix | 191-205 | 15 | |
| β-strand | 215-217 | 3 | 14 |
| β-strand | 218 | 1 | 16 |
| β-strand | 220 | 1 | 14 |
| β-strand | 228 | 1 | 16 |
| α-helix | 231-236 | 6 | |
Chain E: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-25 | 6 | |
| α-helix | 29-31 | 3 | |
| β-strand | 35-39 | 5 | 17 |
| β-strand | 44-49 | 6 | 17 |
| β-strand | 59 | 1 | 15 |
| β-strand | 63-65 | 3 | 18 |
| β-strand | 70-76 | 7 | 18 |
| α-helix | 78-98 | 21 | |
| α-helix | 102-104 | 3 | |
| α-helix | 105-117 | 13 | |
| α-helix | 118-120 | 3 | |
| β-strand | 122 | 1 | 19 |
| β-strand | 130-138 | 9 | 18 |
| β-strand | 141-147 | 7 | 18 |
| β-strand | 153-156 | 4 | 18 |
| β-strand | 158-161 | 4 | 17 |
| α-helix | 166-174 | 9 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-195 | 12 | |
| α-helix | 196-198 | 3 | |
| β-strand | 210-215 | 6 | 17 |
| β-strand | 222-224 | 3 | 17 |
| α-helix | 230-233 | 4 | |
Chain F: 13 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-29 | 8 | |
| α-helix | 30-33 | 4 | |
| β-strand | 37-41 | 5 | 20 |
| β-strand | 45-53 | 9 | 20 |
| β-strand | 59 | 1 | 18 |
| α-helix | 60 | 1 | |
| β-strand | 67-69 | 3 | 21 |
| β-strand | 75-80 | 6 | 21 |
| α-helix | 82-103 | 22 | |
| α-helix | 106-108 | 3 | |
| α-helix | 109-121 | 13 | |
| α-helix | 122-124 | 3 | |
| β-strand | 129 | 1 | 19 |
| β-strand | 134-142 | 9 | 21 |
| β-strand | 146-152 | 7 | 21 |
| β-strand | 158-160 | 3 | 21 |
| β-strand | 161 | 1 | 22 |
| β-strand | 163-166 | 4 | 20 |
| α-helix | 170-177 | 8 | |
| α-helix | 182-184 | 3 | |
| α-helix | 187-201 | 15 | |
| β-strand | 210-218 | 9 | 20 |
| α-helix | 219-221 | 3 | |
| β-strand | 225-227 | 3 | 20 |
| α-helix | 228-229 | 2 | |
| α-helix | 230-243 | 14 | |
Chain G: 9 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 23 |
| α-helix | 23-30 | 8 | |
| α-helix | 31-34 | 4 | |
| β-strand | 38-43 | 6 | 24 |
| β-strand | 47-53 | 7 | 24 |
| β-strand | 61 | 1 | 22 |
| α-helix | 63-65 | 3 | |
| β-strand | 69-71 | 3 | 25 |
| β-strand | 76-82 | 7 | 25 |
| α-helix | 84-105 | 22 | |
| α-helix | 108-110 | 3 | |
| α-helix | 111-125 | 15 | |
| β-strand | 128 | 1 | 5 |
| β-strand | 136-143 | 8 | 25 |
| β-strand | 149-154 | 6 | 25 |
| β-strand | 160-162 | 3 | 25 |
| β-strand | 163 | 1 | 2 |
| β-strand | 165-169 | 5 | 24 |
| α-helix | 172-185 | 14 | |
| α-helix | 191-205 | 15 | |
| β-strand | 215-221 | 7 | 24 |
| β-strand | 228-229 | 2 | 24 |
| α-helix | 232-243 | 12 | |
Chain H: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 48-53 | 6 | |
| α-helix | 55-70 | 16 | |
| α-helix | 74-86 | 13 | |
| α-helix | 100-106 | 7 | |
| α-helix | 114-117 | 4 | |
| α-helix | 130-137 | 8 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Proteasome subunit alpha type-2 | A | protein | 234 | Homo sapiens | P25787 (AlphaFold model) |
| Proteasome subunit alpha type-4 | B | protein | 261 | Homo sapiens | P25789 (AlphaFold model) |
| Proteasome subunit alpha type-7 | C | protein | 248 | Homo sapiens | O14818 (AlphaFold model) |
| Proteasome subunit alpha type-5 | D | protein | 242 | Homo sapiens | P28066 (AlphaFold model) |
| Proteasome subunit alpha type-1 | E | protein | 264 | Homo sapiens | P25786 |
| Proteasome subunit alpha type-3 | F | protein | 255 | Homo sapiens | P25788 |
| Proteasome subunit alpha type-6 | G | protein | 246 | Homo sapiens | P60900 |
| Proteasome maturation protein | H | protein | 141 | Homo sapiens | Q9Y244 |
| Proteasome assembly chaperone 1 | I | protein | 288 | Homo sapiens | O95456 |
| Proteasome assembly chaperone 2 | J | protein | 265 | Homo sapiens | Q969U7 |
| Proteasome subunit beta type-7 | K | protein | 332 | Homo sapiens | Q99436 |
| Proteasome subunit beta type-3 | L | protein | 205 | Homo sapiens | P49720 |
Sequence of entity 1 (A), FASTA
>8QYL_1 Proteasome subunit alpha type-2 (chains A)
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Sequence of entity 2 (B), FASTA
>8QYL_2 Proteasome subunit alpha type-4 (chains B)
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
Sequence of entity 3 (C), FASTA
>8QYL_3 Proteasome subunit alpha type-7 (chains C)
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
Sequence of entity 4 (D), FASTA
>8QYL_4 Proteasome subunit alpha type-5 (chains D)
XMFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLM
EPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNL
ALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQS
SLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIK
DI
Sequence of entity 5 (E), FASTA
>8QYL_5 Proteasome subunit alpha type-1 (chains E)
XMFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAH
QKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIP
TQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEF
MECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEER
PQRKAQPAQPADEPAEKADEPMEH
Sequence of entity 6 (F), FASTA
>8QYL_6 Proteasome subunit alpha type-3 (chains F)
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Sequence of entity 7 (G), FASTA
>8QYL_7 Proteasome subunit alpha type-6 (chains G)
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Sequence of entity 8 (H), FASTA
>8QYL_8 Proteasome maturation protein (chains H)
MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQD
KMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILND
PSQSEVMGEPHLMVEYKLGLL
Sequence of entity 9 (I), FASTA
>8QYL_9 Proteasome assembly chaperone 1 (chains I)
MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEV
SLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAF
CVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSES
TGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVM
KLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Sequence of entity 10 (J), FASTA
>8QYL_10 Proteasome assembly chaperone 2 (chains J)
XMFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNN
PYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVI
VLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCI
RIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPT
VSASRWKIPSSWRLLFGSGLPPALF
Sequence of entity 11 (K), FASTA
>8QYL_11 Proteasome subunit beta type-7 (chains K)
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTSEDLYFQSVDSAWSHPQFEKGGGS
GGGSGGSAWSHPQFEKXXXXXXXXXXXXXXXX
Sequence of entity 12 (L), FASTA
>8QYL_12 Proteasome subunit beta type-3 (chains L)
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Primary citation
Visualizing chaperone-mediated multistep assembly of the human 20S proteasome. Adolf, F., Du, J., Goodall, E.A. et al. Nat Struct Mol Biol (2024) 31:1176-1188. DOI 10.1038/s41594-024-01268-9 · PubMed
Other PDB entries of the same protein (UniProt P25787 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5LE5 1.8 Å, Native human 20S proteasome at 1.8 Angstrom
- 9TMN 1.85 Å, Human sperm 20S proteasome complex isolated from native source
- 5LEY 1.9 Å, Human 20S proteasome complex with Oprozomib at 1.9 Angstrom
- 5LF4 1.99 Å, Human 20S proteasome complex with Delanzomib at 2.0 Angstrom
- 5LF1 2.0 Å, Human 20S proteasome complex with Dihydroeponemycin at 2.0 Angstrom
- 5LF7 2.0 Å, Human 20S proteasome complex with Ixazomib at 2.0 Angstrom
- 8UD9 2.04 Å, Structure of human constitutive 20S proteasome complexed with the inhibitor TDI-8304
- 5LF6 2.07 Å, Human 20S proteasome complex with Z-LLY-ketoaldehyde at 2.1 Angstrom
- 5LF3 2.1 Å, Human 20S proteasome complex with Bortezomib at 2.1 Angstrom
- 8BZL 2.14 Å, Human 20S Proteasome in complex with peptide activator peptide BLM42
- 5LEZ 2.19 Å, Human 20S proteasome complex with Oprozomib in Mg-Acetate at 2.2 Angstrom
- 5LEX 2.2 Å, Native human 20S proteasome in Mg-Acetate at 2.2 Angstrom
Browse structure collections
About this viewer
MolViewer shows 8QYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.