8RAL: CL3E peptide

CL3E peptide bound to the I-Ab murine MHC class II receptor. Determined by X-ray diffraction at 2.1 Å resolution. Released 6 Nov 2024.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, synthetic construct
Chains: 3
Atoms: 3,013
Mol. weight: 50.11 kDa
Released: 6 Nov 2024

Explore 8RAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RAL contains 14 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-17	12	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	42-45	4	1
α-helix	48-52	5
β-strand	55	1	2
α-helix	59-78	20
α-helix	82-86	5
β-strand	90-95	6	3
β-strand	105-114	10	3
β-strand	120-125	6	4
β-strand	128-129	2	4
β-strand	134-136	3	3
α-helix	137-139	3
β-strand	140-141	2	3
β-strand	147-155	9	3
β-strand	163-168	6	4
β-strand	176-180	5	4

Chain B: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	1
β-strand	23-32	10	1
β-strand	35-41	7	1
β-strand	46-49	4	1
α-helix	52-54	3
α-helix	55-63	9
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-82	2
α-helix	83-87	5
α-helix	88-89	2
β-strand	96	1	5
α-helix	97-98	2
β-strand	99-104	6	6
β-strand	115-123	9	6
β-strand	124	1	5
β-strand	129-134	6	7
β-strand	137-139	3	7
β-strand	143-145	3	6
α-helix	146-148	3
β-strand	149-150	2	6
β-strand	156-163	8	6
β-strand	172-177	6	7
β-strand	185-188	4	7

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	0	1	2
α-helix	6-10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, A-B alpha chain	A	protein	195	Mus musculus	P14434 (AlphaFold model)
H-2 class II histocompatibility antigen, A beta chain	B	protein	224	Mus musculus	P14483 (AlphaFold model)
CL3E peptide	C	protein	13	synthetic construct

Sequence of entity 1 (A), FASTA

>8RAL_1 H-2 class II histocompatibility antigen, A-B alpha chain (chains A)
EDDIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLASFDP
QGGLQNIAVVKHNLGCLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPV
INITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLK
HWEPEIPAPMSELTE

Sequence of entity 2 (B), FASTA

>8RAL_2 H-2 class II histocompatibility antigen, A beta chain (chains B)
GLYLEAVPLQVGCGGGSGGSGGGGSGDSERHFVYQFMGECYFTNGTQRIRYVTRYIYNRE
EYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRL
EQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWT
FQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSESAWSK

Sequence of entity 3 (C), FASTA

>8RAL_3 CL3E peptide (chains C)
GLYLEAVPLQVGC

Primary citation

CL3E peptide bound to the I-Ab murine MHC class II receptor. Lopez-Sagaseta, J., Erausquin, E., Urdiciain, A. et al. To be published.

Other PDB entries of the same protein (UniProt P14434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VQ8 2.01 Å, Immune receptor complex
1MUJ 2.15 Å, Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide
4P23 2.25 Å, J809.B5 TCR bound to IAb/3K
1LNU 2.5 Å, Crystal structure of class II MHC molecule iab bound to EALPHA3K peptide
3C5Z 2.55 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR B3K506
6MNG 2.66 Å, 4738 TCR bound to IAb Padi4
3RDT 2.7 Å, Crystal Structure of 809.B5 TCR complexed with MHC Class II I-Ab/3k peptide
6MNN 2.83 Å, 6236 TCR bound to I-Ab Padi4
4P46 2.85 Å, J809.B5 Y31A TCR bound to IAb3K
6MNO 2.9 Å, 6235 TCR bound to I-Ab Padi4
9AUD 2.9 Å, Immune receptor complex
3C60 3.05 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR YAe62

Browse structure collections

About this viewer

MolViewer shows 8RAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.