Erk2 MAP kinase T188E mutant. Determined by X-ray diffraction at 1.55 Å resolution. Released 15 Jan 2025.
Explore 8RM2 in 3D Show helices and sheets RCSB PDB PDBe
8RM2 contains 24 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| β-strand | 16 | 1 | 1 |
| β-strand | 23-31 | 9 | 2 |
| β-strand | 36-42 | 7 | 2 |
| β-strand | 47-54 | 8 | 2 |
| α-helix | 60-75 | 16 | |
| β-strand | 81 | 1 | 3 |
| α-helix | 82-84 | 3 | |
| β-strand | 86-88 | 3 | 2 |
| β-strand | 99-104 | 6 | 2 |
| β-strand | 108-109 | 2 | 3 |
| α-helix | 110-116 | 7 | |
| α-helix | 118-120 | 3 | |
| α-helix | 121-140 | 20 | |
| β-strand | 143-144 | 2 | 4 |
| α-helix | 150-152 | 3 | |
| β-strand | 153-155 | 3 | 3 |
| β-strand | 161-163 | 3 | 3 |
| β-strand | 170-171 | 2 | 4 |
| α-helix | 174-176 | 3 | |
| β-strand | 178 | 1 | 5 |
| α-helix | 189-191 | 3 | |
| α-helix | 194-198 | 5 | |
| β-strand | 200 | 1 | 5 |
| α-helix | 206-221 | 16 | |
| α-helix | 231-242 | 12 | |
| α-helix | 245-246 | 2 | |
| α-helix | 247-251 | 5 | |
| α-helix | 256-264 | 9 | |
| α-helix | 266-267 | 2 | |
| α-helix | 269-272 | 4 | |
| α-helix | 273-276 | 4 | |
| α-helix | 282-291 | 10 | |
| α-helix | 300-301 | 2 | |
| α-helix | 302-306 | 5 | |
| α-helix | 309-311 | 3 | |
| α-helix | 317-319 | 3 | |
| α-helix | 338-348 | 11 | |
| α-helix | 350-352 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 1 | A | protein | 365 | Rattus norvegicus | P63086 (AlphaFold model) |
>8RM2_1 Mitogen-activated protein kinase 1 (chains A) AHHHHHHMAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKK ISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKL LKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVAD PDHDHTGFLTEYVAERWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLD QLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLT FNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ PGYRS
Erk2 MAP kinase T188E mutant. Livnah, O., Gutman, D. To be published.
Other PDB entries of the same protein (UniProt P63086 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8RM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.