8RPP: PDB entry 8RPP

Crystal structure of the JIP1-JIP2-SH3 heterodimer and the JIP2-JIP2-SH3 homodimer. Determined by X-ray diffraction at 1.87 Å resolution. Released 10 Jul 2024.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,252
Mol. weight: 29.54 kDa
Released: 10 Jul 2024

Explore 8RPP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RPP contains 9 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	609-611	3	1
β-strand	615	1	2
β-strand	622	1	1
α-helix	623-624	2
β-strand	625	1	2
β-strand	630-636	7	1
β-strand	641-646	6	1
β-strand	651-656	6	1
α-helix	657-659	3
β-strand	660-662	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	609-611	3	3
β-strand	615	1	4
β-strand	622	1	3
α-helix	623-624	2
β-strand	625	1	4
β-strand	630-636	7	3
β-strand	641-646	6	3
β-strand	652-656	5	3
α-helix	657-659	3
β-strand	660-662	3	3

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	604-606	3
β-strand	609-611	3	5
β-strand	615	1	6
β-strand	622	1	5
α-helix	623-624	2
β-strand	625	1	6
β-strand	630-636	7	5
β-strand	641-646	6	5
β-strand	652-656	5	5
α-helix	657-659	3
β-strand	660-662	3	5

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	493-495	3	7
β-strand	499	1	8
β-strand	506	1	7
α-helix	507-508	2
β-strand	509	1	8
β-strand	514-520	7	7
β-strand	525-530	6	7
β-strand	536-540	5	7
α-helix	541-543	3
β-strand	544-546	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-Jun-amino-terminal kinase-interacting protein 2	A, B, C	protein	63	Homo sapiens	Q13387 (AlphaFold model)
C-Jun-amino-terminal kinase-interacting protein 1	D	protein	61	Homo sapiens	Q9UQF2 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8RPP_1 C-Jun-amino-terminal kinase-interacting protein 2 (chains A, B, C)
GRREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHA
VPG

Sequence of entity 2 (D), FASTA

>8RPP_2 C-Jun-amino-terminal kinase-interacting protein 1 (chains D)
GHMEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIE
V

Primary citation

Structural basis of homodimerization of the JNK scaffold protein JIP2 and its heterodimerization with JIP1. Marino Perez, L., Ielasi, F.S., Lee, A. et al. Structure (2024) 32:1394. DOI 10.1016/j.str.2024.06.010 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8RPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.