ATPase family AAA domain containing 2 with crystallization epitope mutations V1022R:Q1027E. Determined by X-ray diffraction at 1.36 Å resolution. Released 6 Mar 2024.
Explore 8RU5 in 3D Show helices and sheets RCSB PDB PDBe
8RU5 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 980-1002 | 23 | |
| α-helix | 1004-1009 | 6 | |
| α-helix | 1021-1024 | 4 | |
| α-helix | 1031-1039 | 9 | |
| α-helix | 1046-1063 | 18 | |
| α-helix | 1069-1092 | 24 | |
| α-helix | 1095-1107 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATPase family AAA domain-containing protein 2 | A | protein | 130 | Homo sapiens | Q6PL18 (AlphaFold model) |
>8RU5_1 ATPase family AAA domain-containing protein 2 (chains A) SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYRTVIKEPMDLSSVISKI DLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR
A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants. Fairhead, M., Strain-Damerell, C., Ye, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q6PL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8RU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.