8RUC: Activated spinach rubisco

Activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate. Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Aug 1996.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Spinacia oleracea
Chains: 8
Atoms: 20,368
Mol. weight: 271.48 kDa
Ligands: MG, CAP
Released: 1 Aug 1996

Explore 8RUC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RUC contains 130 α-helices and 112 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	1
α-helix	29-32	4
β-strand	36-44	9	1
α-helix	45	1
α-helix	50-59	10
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	1
α-helix	90	1
β-strand	97-103	7	1
α-helix	105-107	3
α-helix	113-121	9
α-helix	124-126	3
β-strand	130-139	10	1
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	2
β-strand	173	1	3
α-helix	182-194	13
β-strand	199-201	3	3
β-strand	209	1	4
β-strand	212	1	4
α-helix	214-232	19
β-strand	237-239	3	3
β-strand	240-241	2	2
α-helix	247-260	14
β-strand	264-268	5	2
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	2
α-helix	298-302	5
β-strand	308-309	2	1
α-helix	311-321	11
β-strand	325-327	3	2
α-helix	339-350	12
β-strand	353-354	2	5
β-strand	357	1	6
α-helix	358-360	3
β-strand	362	1	6
β-strand	366-367	2	5
α-helix	371-373	3
β-strand	375-379	5	2
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	2
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-448	12
α-helix	453-462	10

Chain C: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	7
β-strand	36-44	9	7
α-helix	45	1
α-helix	50-60	11
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	7
α-helix	90	1
β-strand	97-103	7	7
α-helix	105-107	3
α-helix	113-121	9
α-helix	124-126	3
β-strand	130-139	10	7
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	8
β-strand	173	1	9
α-helix	182-194	13
β-strand	199-201	3	9
β-strand	209	1	10
β-strand	212	1	10
α-helix	214-232	19
β-strand	237-239	3	9
β-strand	240-241	2	8
α-helix	247-260	14
β-strand	264-268	5	8
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	8
α-helix	298-302	5
β-strand	308-309	2	7
α-helix	311-321	11
β-strand	325-327	3	8
α-helix	339-350	12
β-strand	353-354	2	11
β-strand	357	1	12
α-helix	358-360	3
β-strand	362	1	12
β-strand	366-367	2	11
α-helix	371-373	3
β-strand	375-379	5	8
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	8
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-449	13
α-helix	453-462	10

Chain E: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	13
β-strand	36-44	9	13
α-helix	45	1
α-helix	50-60	11
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	13
α-helix	90	1
β-strand	97-103	7	13
α-helix	105-107	3
α-helix	113-120	8
α-helix	124-126	3
β-strand	130-139	10	13
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	14
β-strand	173	1	15
α-helix	182-194	13
β-strand	199-201	3	15
β-strand	209	1	16
β-strand	212	1	16
α-helix	214-232	19
β-strand	237-239	3	15
β-strand	240-241	2	14
α-helix	247-260	14
β-strand	264-268	5	14
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	14
α-helix	298-302	5
β-strand	308-309	2	13
α-helix	311-321	11
β-strand	325-327	3	14
α-helix	339-350	12
β-strand	353-354	2	17
β-strand	357	1	18
α-helix	358-360	3
β-strand	362	1	18
β-strand	366-367	2	17
α-helix	371-373	3
β-strand	375-379	5	14
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	14
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-449	13
α-helix	453-462	10

Chain G: 28 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	19
α-helix	29-32	4
β-strand	36-44	9	19
α-helix	45	1
α-helix	50-60	11
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	19
α-helix	90	1
β-strand	97-103	7	19
α-helix	105-107	3
α-helix	113-121	9
α-helix	124-126	3
β-strand	130-139	10	19
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	20
β-strand	173	1	21
α-helix	182-193	12
β-strand	199-201	3	21
β-strand	209	1	22
β-strand	212	1	22
α-helix	214-232	19
β-strand	237-239	3	21
β-strand	240-241	2	20
α-helix	247-260	14
β-strand	264-268	5	20
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	20
α-helix	298-302	5
β-strand	308-309	2	19
α-helix	311-321	11
β-strand	325-327	3	20
α-helix	339-350	12
β-strand	353-354	2	23
β-strand	357	1	24
α-helix	358-360	3
β-strand	362	1	24
β-strand	366-367	2	23
α-helix	371-373	3
β-strand	375-379	5	20
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	20
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-449	13
α-helix	453-462	10

Chains I, J and L: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	20-22	3
α-helix	23-35	13
α-helix	38	1
β-strand	39-45	7	25
β-strand	52	1	26
β-strand	63	1	26
β-strand	68-70	3	25
α-helix	80-93	14
β-strand	98-105	8	25
β-strand	110-118	9	25

Chain K: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	19-22	4
α-helix	23-35	13
α-helix	38	1
β-strand	39-45	7	29
β-strand	52	1	30
β-strand	63	1	30
β-strand	68-70	3	29
α-helix	80-93	14
β-strand	98-105	8	29
β-strand	110-118	9	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribulose-1,5-bisphosphate carboxylase/oxygenase	A, C, E, G	protein	475	Spinacia oleracea	P00875 (AlphaFold model)
Ribulose-1,5-bisphosphate carboxylase/oxygenase	I, J, K, L	protein	123	Spinacia oleracea	P00870 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>8RUC_1 RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE (chains A, C, E, G)
MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSR
GIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV

Sequence of entity 2 (I, J, K, L), FASTA

>8RUC_2 RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE (chains I, J, K, L)
MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPG
YYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKP
AGY

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
CAP	2-carboxyarabinitol-1,5-diphosphate	C6 H14 O13 P2	4

Primary citation

Large structures at high resolution: the 1.6 A crystal structure of spinach ribulose-1,5-bisphosphate carboxylase/oxygenase complexed with 2-carboxyarabinitol bisphosphate. Andersson, I. J Mol Biol (1996) 259:160-174. DOI 10.1006/jmbi.1996.0310 · PubMed

Other PDB entries of the same protein (UniProt P00875 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IR1 1.8 Å, Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco)…
1AA1 2.2 Å, Activated spinach rubisco in complex with the product 3-phosphoglycerate
1AUS 2.2 Å, Activated unliganded spinach rubisco
1RXO 2.2 Å, Activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and…
1RBO 2.3 Å, Spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5-diphosphate
1RCO 2.3 Å, Spinach rubisco in complex with the inhibitor D-xylulose-2,2-diol-1,5-bisphosphate
1UPM 2.3 Å, Activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and CA2+.
1UPP 2.3 Å, Spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
8QJ0 2.3 Å, Room-temperature Serial Synchrotron Crystallography structure of Spinacia oleracea RuBisCO
1RCX 2.4 Å, Non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
9CQ5 2.5 Å, Mn-bound RuBisCO from spinach with CABP inhibitor

Browse more

8RUC is part of these collections:

Photosynthesis

About this viewer

MolViewer shows 8RUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.