Crystal structure of the TYK2 pseudokinase domain in complex with compound 11. Determined by X-ray diffraction at 1.71 Å resolution. Released 26 Jul 2023.
Explore 8S99 in 3D Show helices and sheets RCSB PDB PDBe
8S99 contains 57 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 582 | 1 | |
| β-strand | 583 | 1 | 1 |
| α-helix | 584-585 | 2 | |
| α-helix | 586-588 | 3 | |
| β-strand | 589-598 | 10 | 1 |
| β-strand | 601-609 | 9 | 1 |
| β-strand | 636-644 | 9 | 1 |
| α-helix | 645 | 1 | |
| α-helix | 649-664 | 16 | |
| β-strand | 670 | 1 | 2 |
| β-strand | 673-679 | 7 | 1 |
| β-strand | 682-688 | 7 | 1 |
| β-strand | 694 | 1 | 2 |
| α-helix | 695-701 | 7 | |
| α-helix | 708-728 | 21 | |
| α-helix | 737-739 | 3 | |
| β-strand | 740-744 | 5 | 2 |
| β-strand | 754-757 | 4 | 2 |
| α-helix | 758-759 | 2 | |
| α-helix | 764-766 | 3 | |
| α-helix | 769-774 | 6 | |
| α-helix | 781-783 | 3 | |
| α-helix | 794-808 | 15 | |
| α-helix | 820-828 | 9 | |
| α-helix | 831-836 | 6 | |
| α-helix | 839-848 | 10 | |
| α-helix | 853-855 | 3 | |
| α-helix | 857-858 | 2 | |
| α-helix | 859-866 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 582 | 1 | |
| β-strand | 583-584 | 2 | 3 |
| α-helix | 585 | 1 | |
| α-helix | 586-588 | 3 | |
| β-strand | 589-598 | 10 | 3 |
| β-strand | 601-609 | 9 | 3 |
| β-strand | 636-644 | 9 | 3 |
| α-helix | 645 | 1 | |
| α-helix | 649-663 | 15 | |
| β-strand | 670 | 1 | 4 |
| β-strand | 673-679 | 7 | 3 |
| β-strand | 682-688 | 7 | 3 |
| β-strand | 694 | 1 | 4 |
| α-helix | 695-701 | 7 | |
| α-helix | 708-727 | 20 | |
| α-helix | 737-739 | 3 | |
| β-strand | 740-744 | 5 | 4 |
| β-strand | 754-757 | 4 | 4 |
| α-helix | 758-759 | 2 | |
| α-helix | 764-766 | 3 | |
| α-helix | 769-774 | 6 | |
| α-helix | 781-783 | 3 | |
| α-helix | 794-808 | 15 | |
| α-helix | 820-828 | 9 | |
| α-helix | 831-834 | 4 | |
| α-helix | 839-848 | 10 | |
| α-helix | 853-855 | 3 | |
| α-helix | 857-858 | 2 | |
| α-helix | 859-866 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 582 | 1 | |
| β-strand | 583-584 | 2 | 5 |
| α-helix | 585 | 1 | |
| α-helix | 586-588 | 3 | |
| β-strand | 589-598 | 10 | 5 |
| β-strand | 601-608 | 8 | 5 |
| β-strand | 637-644 | 8 | 5 |
| α-helix | 645 | 1 | |
| α-helix | 649-664 | 16 | |
| β-strand | 670 | 1 | 6 |
| β-strand | 673-679 | 7 | 5 |
| β-strand | 682-688 | 7 | 5 |
| β-strand | 694 | 1 | 6 |
| α-helix | 695-701 | 7 | |
| α-helix | 708-728 | 21 | |
| α-helix | 737-739 | 3 | |
| β-strand | 740-744 | 5 | 6 |
| β-strand | 754-757 | 4 | 6 |
| α-helix | 758-759 | 2 | |
| α-helix | 764-766 | 3 | |
| α-helix | 769-774 | 6 | |
| α-helix | 781-783 | 3 | |
| α-helix | 794-808 | 15 | |
| α-helix | 820-828 | 9 | |
| α-helix | 831-835 | 5 | |
| α-helix | 839-848 | 10 | |
| α-helix | 853-855 | 3 | |
| α-helix | 857-858 | 2 | |
| α-helix | 859-866 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Non-receptor tyrosine-protein kinase TYK2 | A, B, C | protein | 295 | Homo sapiens | P29597 (AlphaFold model) |
>8S99_1 Non-receptor tyrosine-protein kinase TYK2 (chains A, B, C) NLSQLSFHRVDQKEITQLSHLGQGTRTNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRG QELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGP LDVWLRRERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEGTSPF IKLSDPGVGLGALSREERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAP LQSRSPSEKEHFYQRQHRLPEPSCPQLATLTSQCLTYEPTQRPSFRTILRDLTRL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZS3 | (8S)-N-[(1R,2S)-2-fluorocyclopropyl]-5-{[(1M,2'M)-3'-fluoro-2-oxo-2H-[1,2'-bipy… | C21 H18 F2 N8 O2 | 3 |
Water and common crystallization additives (ACT, EDO) are not listed.
Discovery of a Potent and Selective Tyrosine Kinase 2 Inhibitor: TAK-279. Leit, S., Greenwood, J., Carriero, S. et al. J Med Chem (2023) 66:10473-10496. DOI 10.1021/acs.jmedchem.3c00600 · PubMed
Other PDB entries of the same protein (UniProt P29597 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8S99 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.