8SCA: Rec3 Domain from S. pyogenes Cas9

Rec3 Domain from S. pyogenes Cas9. Determined by X-ray diffraction at 1.67 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Streptococcus pyogenes
Chains: 1
Atoms: 2,033
Mol. weight: 26.13 kDa
Released: 13 Mar 2024

Explore 8SCA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SCA contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	498-499	2	1
β-strand	502-506	5	1
α-helix	507-508	2
β-strand	509	1	2
α-helix	513-524	12
β-strand	528-530	3	3
β-strand	538-539	2	3
α-helix	540-541	2
α-helix	542-548	7
α-helix	549-553	5
β-strand	560	1	4
α-helix	561-563	3
α-helix	564-570	7
β-strand	579-581	3	3
β-strand	584	1	4
β-strand	586	1	4
α-helix	592-601	10
α-helix	604-608	5
α-helix	610-612	3
α-helix	613-625	13
α-helix	629-636	8
α-helix	637-639	3
α-helix	645-651	7
β-strand	659	1	2
α-helix	664-668	5
β-strand	671	1	5
β-strand	678	1	5
α-helix	679-684	6
β-strand	686	1	6
β-strand	688	1	6
α-helix	693-698	6
α-helix	704-711	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas9/Csn1	B	protein	218	Streptococcus pyogenes	Q99ZW2 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8SCA_1 CRISPR-associated endonuclease Cas9/Csn1 (chains B)
SNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKT
NRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDI
LEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQS
GKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQV

Primary citation

High-fidelity, hyper-accurate, and evolved mutants rewire atomic-level communication in CRISPR-Cas9. Skeens, E., Sinha, S., Ahsan, M. et al. Sci Adv (2024) 10:eadl1045-eadl1045. DOI 10.1126/sciadv.adl1045 · PubMed

Other PDB entries of the same protein (UniProt Q99ZW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O56 1.9 Å, HNH Nuclease from S. pyogenes Cas9
5B2R 2.0 Å, Crystal structure of the Streptococcus pyogenes Cas9 VQR variant in complex with sgRNA…
5FQ5 2.14 Å, Crystal structure of Cas9-sgRNA-DNA complex solved by native SAD phasing
7OXA 2.15 Å, Target-bound SpCas9 complex with AAVS1 chimeric RNA-DNA guide
5B2S 2.2 Å, Crystal structure of the Streptococcus pyogenes Cas9 EQR variant in complex with sgRNA…
5B2T 2.2 Å, Crystal structure of the Streptococcus pyogenes Cas9 VRER variant in complex with sgRNA…
7QQV 2.25 Å, SpCas9 bound to FANCF off-target3 DNA substrate
7QQZ 2.25 Å, SpCas9 bound to FANCF off-target7 DNA substrate
7QR0 2.3 Å, SpCas9 bound to TRAC off-target1 DNA substrate
4UN4 2.37 Å, Crystal structure of Cas9 bound to PAM-containing DNA target with mismatches at…
4UN5 2.4 Å, Crystal structure of Cas9 bound to PAM-containing DNA target containing mismatches at…
7QQS 2.4 Å, SpCas9 bound to FANCF on-target DNA substrate

Browse structure collections

About this viewer

MolViewer shows 8SCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.