8SGL: CCT G beta 5 complex closed state 15

Name: PDB 8SGL: CCT G beta 5 complex closed state 15
Published: 2023-10-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

CCT G beta 5 complex closed state 15. Determined by electron microscopy at 2.9 Å resolution. Released 25 Oct 2023.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 17
Atoms: 67,432
Mol. weight: 979.23 kDa
Ligands: AF3, MG, ADP
Released: 25 Oct 2023

Explore 8SGL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SGL contains 378 α-helices and 438 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 23 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	64
α-helix	15-32	18
α-helix	33-35	3
β-strand	42-47	6	65
β-strand	52-55	4	65
α-helix	58-64	7
β-strand	67	1	66
α-helix	70-85	16
α-helix	92-109	18
α-helix	114-135	22
β-strand	138-139	2	67
α-helix	140-142	3
α-helix	145-156	12
α-helix	165-178	14
β-strand	181-182	2	68
α-helix	184-186	3
β-strand	188-189	2	68
β-strand	196-199	4	69
α-helix	205-207	3
β-strand	209-211	3	69
β-strand	213-216	4	70
β-strand	228-229	2	70
β-strand	232-237	6	70
β-strand	241	1	71
β-strand	250-254	5	72
α-helix	259-280	22
β-strand	285-288	4	70
β-strand	292	1	71
α-helix	294-303	10
β-strand	306-308	3	70
α-helix	313-323	11
β-strand	328	1	70
β-strand	332	1	73
β-strand	338	1	73
α-helix	342-344	3
β-strand	346-355	10	70
β-strand	360-367	8	70
β-strand	374-377	4	69
α-helix	382-404	23
β-strand	407-410	4	67
α-helix	414-426	13
α-helix	427-429	3
α-helix	434-444	11
α-helix	447-455	9
α-helix	460-476	17
α-helix	478-485	8
β-strand	486-489	4	74
β-strand	494-497	4	74
β-strand	504-506	3	67
α-helix	507-525	19
β-strand	527-533	7	64

Chain A: 24 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	9-13	5	2
α-helix	15-32	18
α-helix	33-35	3
β-strand	42	1	3
β-strand	43-44	2	4
β-strand	45-46	2	5
β-strand	54-55	2	4
α-helix	58-64	7
β-strand	67	1	6
α-helix	70-85	16
α-helix	90-108	19
α-helix	114-135	22
β-strand	138-139	2	7
α-helix	140-143	4
α-helix	145-156	12
α-helix	165-178	14
β-strand	181-182	2	8
α-helix	184-186	3
β-strand	188-189	2	8
β-strand	196-199	4	9
α-helix	205-207	3
β-strand	209-211	3	9
β-strand	213-216	4	10
β-strand	228-229	2	10
β-strand	232-237	6	10
β-strand	241	1	11
β-strand	250-254	5	12
α-helix	259-280	22
β-strand	285-288	4	10
β-strand	292	1	11
α-helix	294-303	10
β-strand	306-308	3	10
α-helix	313-323	11
β-strand	328	1	10
α-helix	342-344	3
β-strand	346-356	11	10
β-strand	359-367	9	10
β-strand	374-377	4	9
α-helix	382-404	23
β-strand	407-410	4	7
α-helix	414-427	14
α-helix	434-444	11
α-helix	447-455	9
α-helix	460-476	17
α-helix	478-485	8
β-strand	486-489	4	13
β-strand	494-497	4	13
α-helix	498-501	4
β-strand	504-506	3	7
α-helix	507-525	19
β-strand	527-533	7	2
α-helix	534-535	2

Chain b: 21 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	75
α-helix	21-39	19
β-strand	49-53	5	76
β-strand	61-64	4	76
α-helix	67-72	6
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-144	22
β-strand	146-147	2	77
α-helix	152-167	16
α-helix	171-175	5
α-helix	176-188	13
β-strand	199-205	7	78
α-helix	209-211	3
β-strand	213-214	2	78
β-strand	218-220	3	79
β-strand	224	1	79
β-strand	232-240	9	79
β-strand	254-258	5	72
α-helix	261-283	23
β-strand	289-292	4	79
α-helix	298-307	10
β-strand	310-312	3	79
α-helix	317-327	11
β-strand	331-332	2	79
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-354	11	79
β-strand	357-365	9	79
β-strand	371-377	7	78
α-helix	380-402	23
β-strand	405-408	4	77
α-helix	412-427	16
α-helix	432-452	21
α-helix	458-471	14
β-strand	476-479	4	80
β-strand	484-487	4	80
α-helix	488-491	4
β-strand	494-496	3	77
α-helix	497-515	19
β-strand	517-522	6	75
α-helix	523-525	3

Chain B: 22 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	14
α-helix	21-39	19
β-strand	49-53	5	15
β-strand	61-64	4	15
α-helix	67-72	6
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-143	21
β-strand	146-147	2	16
α-helix	152-167	16
α-helix	171-175	5
α-helix	176-188	13
α-helix	196-198	3
β-strand	199-205	7	17
α-helix	209-211	3
β-strand	213-214	2	17
β-strand	218-220	3	18
β-strand	224	1	18
β-strand	232-240	9	18
β-strand	254-258	5	12
α-helix	261-283	23
β-strand	289-292	4	18
α-helix	298-307	10
β-strand	310-312	3	18
α-helix	317-327	11
β-strand	332	1	18
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-354	11	18
β-strand	357-365	9	18
β-strand	371-377	7	17
α-helix	380-402	23
β-strand	405-408	4	16
α-helix	412-426	15
α-helix	431-454	24
α-helix	458-471	14
β-strand	476-479	4	19
β-strand	484-487	4	19
α-helix	488-491	4
β-strand	494-496	3	16
α-helix	497-515	19
β-strand	517-522	6	14
α-helix	523-525	3

Chain d: 24 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	29-47	19
β-strand	58-62	5	64
β-strand	68-71	4	64
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-125	20
α-helix	132-151	20
β-strand	153-154	2	81
α-helix	160-172	13
α-helix	175-177	3
α-helix	180-194	15
α-helix	205-207	3
β-strand	208-212	5	82
β-strand	215	1	83
α-helix	218-220	3
β-strand	222	1	82
β-strand	227-229	3	84
α-helix	232-233	2
β-strand	241-249	9	84
β-strand	253	1	85
β-strand	262-266	5	72
α-helix	269-292	24
β-strand	297-301	5	84
β-strand	309	1	85
α-helix	311-319	9
β-strand	323-328	6	84
α-helix	330-332	3
α-helix	333-340	8
β-strand	345	1	84
α-helix	348-350	3
α-helix	353-355	3
β-strand	357-366	10	84
β-strand	372-379	8	84
β-strand	386-390	5	82
β-strand	392	1	83
α-helix	395-416	22
β-strand	420-423	4	81
α-helix	427-441	15
α-helix	446-458	13
α-helix	460-466	7
α-helix	473-486	14
β-strand	491-494	4	86
β-strand	499-502	4	86
α-helix	504-506	3
β-strand	509-511	3	81
α-helix	512-530	19
β-strand	532-537	6	76

Chain D: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	29-49	21
β-strand	58-62	5	2
β-strand	68-71	4	2
α-helix	74-80	7
β-strand	83	1	1
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-151	22
β-strand	153-154	2	20
α-helix	160-172	13
α-helix	180-192	13
α-helix	205-207	3
β-strand	208-215	8	21
α-helix	218-220	3
β-strand	222-224	3	21
β-strand	227-229	3	22
α-helix	232-233	2
β-strand	240-249	10	22
β-strand	253	1	23
β-strand	262-266	5	12
α-helix	269-291	23
β-strand	297-301	5	22
β-strand	309	1	23
α-helix	311-319	9
β-strand	323-328	6	22
α-helix	330-332	3
α-helix	333-340	8
α-helix	342-344	3
β-strand	345	1	22
α-helix	348-350	3
α-helix	353-355	3
β-strand	357-366	10	22
β-strand	372-379	8	22
β-strand	386-392	7	21
α-helix	395-417	23
β-strand	420-423	4	20
α-helix	427-441	15
α-helix	446-458	13
α-helix	460-468	9
α-helix	473-486	14
β-strand	491-494	4	24
β-strand	499-502	4	24
β-strand	509-511	3	20
α-helix	512-530	19
β-strand	532-537	6	15

Chain e: 23 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	87
α-helix	22-24	3
β-strand	26-29	4	88
α-helix	30-48	19
α-helix	49-51	3
β-strand	58-62	5	75
β-strand	68-71	4	75
α-helix	74-79	6
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-151	22
β-strand	153-154	2	89
α-helix	163-173	11
α-helix	177-181	5
α-helix	182-195	14
α-helix	206-208	3
β-strand	209-216	8	90
α-helix	219-221	3
β-strand	223-225	3	90
β-strand	228-230	3	91
β-strand	234	1	91
β-strand	242-250	9	91
β-strand	251	1	92
β-strand	255	1	93
β-strand	264-268	5	72
α-helix	271-294	24
β-strand	299-301	3	91
β-strand	306	1	93
α-helix	308-316	9
β-strand	321-322	2	91
α-helix	327-337	11
β-strand	342	1	92
α-helix	345-347	3
α-helix	350-352	3
β-strand	354-362	9	91
β-strand	371-375	5	91
β-strand	383-389	7	90
α-helix	392-414	23
β-strand	417-420	4	89
α-helix	424-439	16
α-helix	442-455	14
α-helix	457-465	9
α-helix	470-483	14
β-strand	489	1	94
β-strand	500	1	94
β-strand	507-509	3	89
α-helix	510-528	19
β-strand	530-535	6	88

Chain E: 23 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	25
β-strand	28-29	2	26
α-helix	31-48	18
α-helix	49-51	3
β-strand	58-62	5	14
β-strand	68-71	4	14
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-124	19
α-helix	130-150	21
β-strand	153-154	2	27
α-helix	163-173	11
α-helix	177-180	4
α-helix	182-195	14
α-helix	206-208	3
β-strand	209-216	8	28
α-helix	219-221	3
β-strand	223-225	3	28
β-strand	228-230	3	29
β-strand	234	1	29
β-strand	242-251	10	29
β-strand	255	1	30
β-strand	264-268	5	12
α-helix	271-293	23
β-strand	299-302	4	29
β-strand	306	1	30
α-helix	308-316	9
β-strand	321-322	2	29
α-helix	327-337	11
α-helix	339-340	2
β-strand	341-342	2	29
α-helix	345-347	3
α-helix	350-352	3
β-strand	354-363	10	29
β-strand	370-375	6	29
β-strand	383-389	7	28
α-helix	392-414	23
β-strand	417-420	4	27
α-helix	424-439	16
α-helix	442-455	14
α-helix	457-465	9
α-helix	470-483	14
β-strand	489	1	31
β-strand	500	1	31
β-strand	507-509	3	27
α-helix	510-528	19
β-strand	530-534	5	26

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-complex protein 1 subunit alpha	A, a	protein	536	Homo sapiens	P17987 (AlphaFold model)
T-complex protein 1 subunit beta	B, b	protein	526	Homo sapiens	P78371 (AlphaFold model)
T-complex protein 1 subunit delta	D, d	protein	520	Homo sapiens	P50991 (AlphaFold model)
T-complex protein 1 subunit epsilon	E, e	protein	540	Homo sapiens	P48643 (AlphaFold model)
T-complex protein 1 subunit gamma	G, g	protein	528	Homo sapiens	P49368
T-complex protein 1 subunit eta, N-terminally processed	H, h	protein	528	Homo sapiens	Q99832
T-complex protein 1 subunit theta	Q, q	protein	538	Homo sapiens	P50990
T-complex protein 1 subunit zeta	Z, z	protein	527	Homo sapiens	P40227
Guanine nucleotide-binding protein subunit beta-5	N	protein	395	Homo sapiens	O14775

Sequence of entity 1 (A, a), FASTA

>8SGL_1 T-complex protein 1 subunit alpha (chains A, a)
EGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATI
LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY
RLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKY
TDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSL
QKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFV
EAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDEL
ILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSI
YLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK
NLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPES

Sequence of entity 2 (B, b), FASTA

>8SGL_2 T-complex protein 1 subunit beta (chains B, b)
ASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASL
MVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKI
HPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTK
LAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIAN
TGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPE
QLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIH
FSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAV
TQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMR
EGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRK

Sequence of entity 3 (D, d), FASTA

>8SGL_3 T-complex protein 1 subunit delta (chains D, d)
RGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATIL
KQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQ
KALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPA
TATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKT
DMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLN
KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG
CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE
YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG
GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNT

Sequence of entity 4 (E, e), FASTA

>8SGL_4 T-complex protein 1 subunit epsilon (chains E, e)
ASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMM
VDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAE
QLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSC
HRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPK
KVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAI
CQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQE
ISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYG
GGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQ
VKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Sequence of entity 5 (G, g), FASTA

>8SGL_5 T-complex protein 1 subunit gamma (chains G, g)
GHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTND
GNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVV
ISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKM
VQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLD
SSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQH
YLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTF
ITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHAL
TEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNG
ETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG

Sequence of entity 6 (H, h), FASTA

>8SGL_6 T-complex protein 1 subunit eta, N-terminally processed (chains H, h)
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD

Sequence of entity 7 (Q, q), FASTA

>8SGL_7 T-complex protein 1 subunit theta (chains Q, q)
ALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLE
KLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRI
GLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAK
LIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAV
YSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMA
LHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVV
VFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAK
QITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLD
IEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGK

Sequence of entity 8 (Z, z), FASTA

>8SGL_8 T-complex protein 1 subunit zeta (chains Z, z)
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMS

Sequence of entity 9 (N), FASTA

>8SGL_9 Guanine nucleotide-binding protein subunit beta-5 (chains N)
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA

Ligands and cofactors

ID	Name	Formula	Copies
AF3	Aluminum fluoride	Al F3	16
MG	Magnesium ion	Mg	16
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	16

Primary citation

Visualizing the chaperone-mediated folding trajectory of the G protein beta 5 beta-propeller. Wang, S., Sass, M.I., Kwon, Y. et al. Mol Cell (2023) 83:3852-3868.e6. DOI 10.1016/j.molcel.2023.09.032 · PubMed

Other PDB entries of the same protein (UniProt P17987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVL 2.5 Å, Human TRiC complex in closed state with nanobody bound (Consensus Map)
8SH9 2.7 Å, CCT G beta 5 complex best PhLP1 class
9S72 2.71 Å, Human CCT in Closed Conformation
8SHE 2.8 Å, CCT-G beta 5 complex closed state 8
8SHG 2.8 Å, CCT G beta 5 complex closed state 9
8SHN 2.8 Å, CCT-G beta 5 complex closed state 6
7TTT 2.9 Å, The beta-tubulin folding intermediate III
8SG9 2.9 Å, CCT G beta 5 complex closed state 3
8SGC 2.9 Å, CCT G beta 5 complex closed state 2
8SHD 2.9 Å, CCT G beta 5 complex closed state 10
8SHQ 2.9 Å, CCT G beta 5 complex closed state 12
9NOQ 2.9 Å, CCT G beta 5 R269E complex state 5

Browse structure collections

About this viewer

MolViewer shows 8SGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.