8SHK: Binary complex of mouse cGAS and bound ATP

Structure of binary complex of mouse cGAS and bound ATP. Determined by X-ray diffraction at 1.71 Å resolution. Released 24 Apr 2024.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Mus musculus
Chains: 1
Atoms: 3,304
Mol. weight: 43.21 kDa
Ligands: ZN, ATP
Released: 24 Apr 2024

Explore 8SHK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SHK contains 16 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	146-184	39
β-strand	193-195	3	1
β-strand	211-219	9	1
β-strand	223-227	5	1
β-strand	235-239	5	1
α-helix	249-251	3
β-strand	252-253	2	2
β-strand	256-257	2	2
α-helix	259-274	16
β-strand	281-284	4	1
α-helix	285-287	3
β-strand	294-299	6	1
β-strand	303-314	12	1
α-helix	317-319	3
α-helix	320-322	3
α-helix	334-341	8
β-strand	345-349	5	1
β-strand	363-366	4	1
α-helix	368-376	9
α-helix	394-411	18
α-helix	413-415	3
α-helix	420-433	14
α-helix	437-440	4
α-helix	442-444	3
α-helix	445-462	18
β-strand	466	1	3
β-strand	474	1	3
α-helix	483-498	16
α-helix	502-505	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cyclic GMP-AMP synthase	C	protein	364	Mus musculus	Q8C6L5 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8SHK_1 Cyclic GMP-AMP synthase (chains C)
GTGPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEH
VKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKML
SKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTK
EGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKT
CCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPR
NLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPI
FDKL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

The structural basis for 2'-5'/3'-5'-cGAMP synthesis by cGAS. Wu, S., Gabelli, S.B., Sohn, J. Nat Commun (2024) 15:4012-4012. DOI 10.1038/s41467-024-48365-3 · PubMed

Other PDB entries of the same protein (UniProt Q8C6L5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SHU 1.71 Å, Structure of mouse cGAS
8SHY 1.77 Å, Structure of binary complex of mouse cGAS QN and bound ATP
5XZG 1.83 Å, Mouse cGAS bound to the inhibitor RU521
4O6A 1.86 Å, Mouse cyclic GMP-AMP synthase (cGAS) in complex with DNA
4K98 1.94 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppG(2 ,5 )pG
4K99 1.95 Å, Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppdG(2 ,5 )pdG
4K8V 2.0 Å, Structure of cyclic GMP-AMP Synthase (cGAS)
7UTT 2.04 Å, Structure of Non-hydrolyzable ATP (ApCpp) binds to Cyclic GMP AMP synthase (cGAS)…
4K96 2.08 Å, Structure of Binary Complex of cGAS with Bound dsDNA
5XZB 2.13 Å, Mouse cGAS bound to the inhibitor RU365
7BUJ 2.13 Å, mcGAS bound with pppGpG
5XZE 2.18 Å, Mouse cGAS bound to the inhibitor RU332

Browse structure collections

About this viewer

MolViewer shows 8SHK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.