8SOJ: Human CST

Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA. Determined by electron microscopy at 3.8 Å resolution. Released 7 Jun 2023.

Method: Electron microscopy
Resolution: 3.8 Å
Organisms: Escherichia coli O157:H7, Homo sapiens, Human enterovirus 71
Chains: 4
Atoms: 17,223
Mol. weight: 380.87 kDa
Ligands: ZN
Released: 7 Jun 2023

Explore 8SOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SOJ contains 113 α-helices and 141 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 59 helices, 81 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
α-helix	23-27	5
α-helix	38-52	15
β-strand	66-68	3	1
α-helix	70-76	7
β-strand	81-82	2	1
α-helix	89-96	8
α-helix	104	1
β-strand	105	1	2
α-helix	106-107	2
β-strand	108	1	1
β-strand	111-118	8	1
β-strand	134-136	3	1
β-strand	141-146	6	1
α-helix	151-153	3
β-strand	157-160	4	1
β-strand	163-166	4	1
α-helix	167-169	3
β-strand	178-181	4	1
β-strand	186-187	2	1
α-helix	190-191	2
β-strand	201-204	4	3
α-helix	206-214	9
α-helix	216-218	3
β-strand	226-233	8	3
α-helix	234-236	3
β-strand	237-238	2	4
β-strand	243-244	2	4
β-strand	245-250	6	3
β-strand	258-263	6	3
α-helix	266-270	5
α-helix	271-274	4
β-strand	280-283	4	3
β-strand	286-289	4	3
β-strand	298-301	4	3
β-strand	307-309	3	3
α-helix	312-314	3
β-strand	315-318	4	3
β-strand	350-352	3	5
β-strand	354-367	14	6
β-strand	372-375	4	6
β-strand	379-382	4	6
α-helix	391-393	3
β-strand	400-409	10	6
β-strand	413	1	7
β-strand	416	1	7
β-strand	420-422	3	6
β-strand	428-433	6	6
β-strand	437	1	2
α-helix	438-442	5
α-helix	444-447	4
α-helix	450-455	6
α-helix	456-460	5
α-helix	464-481	18
α-helix	488-491	4
α-helix	494-495	2
α-helix	502-505	4
α-helix	508-514	7
α-helix	519-522	4
α-helix	524-529	6
β-strand	539-541	3	5
β-strand	543	1	7
β-strand	547-548	2	8
α-helix	552-566	15
α-helix	569-572	4
α-helix	577-580	4
α-helix	583-590	8
β-strand	592-596	5	9
α-helix	599-601	3
β-strand	605-606	2	8
β-strand	608-614	7	10
β-strand	621-625	5	10
β-strand	628-631	4	10
β-strand	632-637	6	9
β-strand	640-641	2	9
α-helix	645-647	3
β-strand	651-654	4	10
β-strand	658-665	8	9
α-helix	672-676	5
β-strand	684-693	10	9
α-helix	694-696	3
β-strand	697-700	4	10
α-helix	701-705	5
β-strand	728-738	11	11
β-strand	742-744	3	11
β-strand	746	1	12
α-helix	747-749	3
β-strand	760-775	16	11
β-strand	776-777	2	13
β-strand	780-781	2	13
α-helix	782-786	5
α-helix	791-793	3
β-strand	795-801	7	11
α-helix	802-807	6
β-strand	816-822	7	11
β-strand	842	1	12
α-helix	843-845	3
β-strand	851-853	3	11
β-strand	859-863	5	11
α-helix	866-868	3
α-helix	872-874	3
β-strand	895-908	14	14
α-helix	910-914	5
β-strand	928-935	8	14
α-helix	943-944	2
β-strand	945-950	6	14
α-helix	952-954	3
α-helix	955	1
α-helix	957-958	2
β-strand	966-976	11	14
β-strand	982-985	4	14
β-strand	991-996	6	14
α-helix	997-999	3
α-helix	1006-1008	3
β-strand	1009	1	15
α-helix	1012-1017	6
β-strand	1024-1027	4	15
β-strand	1030-1043	14	15
β-strand	1046-1049	4	15
β-strand	1050-1051	2	16
β-strand	1054-1055	2	16
β-strand	1058	1	17
β-strand	1062	1	17
β-strand	1067-1078	12	15
β-strand	1083-1089	7	15
α-helix	1091-1097	7
α-helix	1101-1111	11
β-strand	1116-1120	5	15
β-strand	1121	1	18
α-helix	1127	1
β-strand	1128	1	18
α-helix	1129	1
α-helix	1137-1145	9
β-strand	1154	1	15
β-strand	1156-1161	6	15
α-helix	1173-1174	2
β-strand	1175-1181	7	19
β-strand	1184-1190	7	19
α-helix	1191-1193	3
β-strand	1194-1202	9	15

Chain B: 21 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	176-192	17
α-helix	201-203	3
α-helix	206-214	9
α-helix	231-239	9
β-strand	421	1	19
α-helix	424-427	4
β-strand	429-430	2	20
α-helix	434-439	6
β-strand	441-442	2	21
β-strand	450-452	3	21
β-strand	455-457	3	21
β-strand	459-471	13	20
β-strand	475-481	7	20
β-strand	486-492	7	20
α-helix	499-502	4
α-helix	507-527	21
β-strand	534-544	11	20
β-strand	547-558	12	20
α-helix	564-576	13
α-helix	577-581	5
α-helix	604-621	18
β-strand	626-628	3	22
α-helix	629-633	5
α-helix	636-642	7
α-helix	645-651	7
α-helix	655-657	3
α-helix	658-679	22
β-strand	683-684	2	22
β-strand	693-696	4	22
α-helix	697-699	3
α-helix	701-711	11
α-helix	714-715	2
β-strand	725-726	2	23
α-helix	727-737	11
α-helix	744-757	14
β-strand	761-764	4	23
β-strand	767-769	3	23

Chain C: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	9	1	24
α-helix	12-16	5
α-helix	21	1
β-strand	25-32	8	24
β-strand	36	1	25
β-strand	41	1	25
β-strand	44-45	2	24
β-strand	46	1	26
β-strand	53	1	26
β-strand	57	1	24
β-strand	72-82	11	24
β-strand	86-97	12	24
α-helix	102-118	17

Chain D: 29 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	159-162	4	27
β-strand	166-175	10	27
β-strand	178-184	7	27
α-helix	188-189	2
α-helix	192	1
β-strand	193	1	27
α-helix	194	1
β-strand	204	1	27
α-helix	207-210	4
α-helix	211-216	6
β-strand	218-222	5	27
α-helix	227-230	4
α-helix	233-234	2
β-strand	238-242	5	27
β-strand	244-249	6	27
β-strand	260-265	6	27
α-helix	270-272	3
β-strand	274-277	4	27
α-helix	278-279	2
α-helix	283-297	15
α-helix	301-303	3
α-helix	317-321	9
α-helix	331-332	2
β-strand	333	1	28
β-strand	335-337	3	29
α-helix	344	1
β-strand	345	1	30
α-helix	348-352	5
α-helix	355	1
β-strand	358-370	13	30
α-helix	374-376	3
β-strand	378-382	5	30
β-strand	387-389	3	30
α-helix	390-393	4
α-helix	394-401	8
α-helix	411-413	3
β-strand	419-426	8	31
β-strand	432-439	8	31
β-strand	441	1	32
β-strand	444	1	32
α-helix	445-447	3
α-helix	448-450	3
β-strand	452-456	5	31
α-helix	460-469	10
β-strand	472-475	4	31
β-strand	477	1	33
β-strand	484	1	33
β-strand	493-495	3	31
β-strand	498-500	3	31
β-strand	502	1	34
α-helix	512-517	6
α-helix	526-532	7
β-strand	537	1	34
α-helix	538	1
β-strand	539-549	11	30
β-strand	554-561	8	30
α-helix	577-590	14
α-helix	601	1
β-strand	602	1	28
β-strand	603-611	9	30
β-strand	620-625	6	30
β-strand	627-629	3	29
α-helix	631-633	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit CTC1	A	protein	1613	Escherichia coli O157:H7, Homo sapiens	P0AEX9 (AlphaFold model), Q2NKJ3 (AlphaFold model)
CST complex subunit STN1	B	protein	1049	Human enterovirus 71, Homo sapiens	B6F2F5, Q96AP0 (AlphaFold model), Q9H668
CST complex subunit TEN1	C	protein	123	Homo sapiens	Q86WV5
Protection of telomeres protein 1	D	protein	646	Homo sapiens	Q9NUX5

Sequence of entity 1 (A), FASTA

>8SOJ_1 CST complex subunit CTC1 (chains A)
MGSSHHHHHHSSGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEK
FPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAY
PIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGG
YAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTI
NGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLT
DEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTA
VINAASGRQTVDEALKDAQTKLVEKYLEVLFQGPGSMAAGRAQVPSSEQAWLEDAQVFIQ
KTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRNQGSTLPLSYSFVSVQDLKTHQRLPCCSH
LSWSSSAYQAWAQEAGPNGNPLPREQLLLLGTLTDLSADLEQECRNGSLYVRDNTGVLSC
ELIDLDLSWLGHLFLFPRWSYLPPARWNSSGEGHLELWDAPVPVFPLTISPGPVTPIPVL
YPESASCLLRLRNKLRGVQRNLAGSLVRLSALVKSKQKAYFILSLGRSHPAVTHVSIIVQ
VPAQLVWHRALRPGTAYVLTELRVSKIRGQRQHVWMTSQSSRLLLLKPECVQELELELEG
PLLEADPKPLPMPSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLA
YQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSS
RQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGL
QLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAW
ASFDPKALLPLPEASYLPSCQLNRRLAWSWLCLLPSAFCPAQVLLGVLVASSHKGCLQLR
DQSGSLPCLLLAKHSQPLSDPRLIGCLVRAERFQLIVERDVRSSFPSWKELSMPGFIQKQ
QARVYVQFFLADALILPVPRPCLHSATPSTPQTDPTGPEGPHLGQSRLFLLCHKEALMKR
NFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQGNDDNDQKVHLIFFGSS
VRWFEFLHPGQVYRLIAPGPATPMLFEKDGSSCISRRPLELAGCASCLTVQDNWTLELES
SQDIQDVLDANKSLPESSLTDLLSDNFTDSLVSFSAEILSRTLCEPLVASLWMKLGNTGA
MRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYC
CFRSSTYVQVLSFPPETTISIPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCA
YCTSICRQGKCTRLGSTCPTQTAISQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREW
ASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTSPSVLRPIVLSFELERK
PSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLSIRESEYSSSLGILASSC

Sequence of entity 2 (B), FASTA

>8SOJ_2 CST complex subunit STN1 (chains B)
MWSHPQFEKGGGSGGGSGGSAWSHPQFEKGSVSKGEELFTGVVPILVELDGDVNGHKFSV
SGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMP
EGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN
VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK
DPNEKRDHMVLLEFVTAAGITLGMDELYKENLYFQGGSMAGSGRLVLRPWIRELILGSET
PSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWE
EKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDL
DVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEGPCTAP
PVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLS
LTLIASPPSSPSSSGTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSA
PATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKN
RPPFPRTGATRGAQEGGSGGSMQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKE
SRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSA
APSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPV
WNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMEN
RVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGL
VFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGL
SEAVLQQVLELLEDQSDIVSTMEHYYTAF

Sequence of entity 3 (C), FASTA

>8SOJ_3 CST complex subunit TEN1 (chains C)
MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
LVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERG
GSQ

Sequence of entity 4 (D), FASTA

>8SOJ_4 Protection of telomeres protein 1 (chains D)
MHHHHHHGSSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQ
TNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGA
PIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKA
EVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARS
LKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDL
ESANLTANQHSDVICQSEPDDSFPSSGSESDLVSLYEVERCQQLSATILTDHQYLERTPL
CAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKT
PDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSN
KFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSS
VAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMD
MFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

POT1 recruits and regulates CST-Pol alpha /primase at human telomeres. Cai, S.W., Takai, H., Zaug, A.J. et al. Cell (2024) 187:3638-3651.e18. DOI 10.1016/j.cell.2024.05.002 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 8SOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.