8SOK: Human CST

Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA. Determined by electron microscopy at 4.1 Å resolution. Released 7 Jun 2023.

Method: Electron microscopy
Resolution: 4.1 Å
Organisms: Escherichia coli O157:H7, Homo sapiens, Human enterovirus 71
Chains: 6
Atoms: 18,574
Mol. weight: 371.16 kDa
Ligands: ZN
Released: 7 Jun 2023

Explore 8SOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SOK contains 113 α-helices and 150 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 57 helices, 89 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
α-helix	22-27	6
α-helix	38-51	14
β-strand	66-68	3	1
α-helix	70-76	7
β-strand	81-83	3	2
α-helix	89-96	8
α-helix	97-99	3
β-strand	105	1	3
α-helix	106-107	2
β-strand	108	1	2
β-strand	111-118	8	1
β-strand	134-136	3	1
β-strand	141-143	3	1
β-strand	144-146	3	2
α-helix	151-153	3
β-strand	157-160	4	1
β-strand	163-166	4	2
β-strand	178-181	4	2
α-helix	184-185	2
β-strand	186-187	2	1
α-helix	190-191	2
α-helix	200	1
β-strand	201-204	4	4
α-helix	206-214	9
α-helix	216-218	3
β-strand	226-233	8	4
β-strand	237-238	2	5
β-strand	243-244	2	5
β-strand	245-250	6	4
β-strand	258-263	6	4
α-helix	266-273	8
β-strand	280-283	4	4
β-strand	286-289	4	4
β-strand	298-301	4	4
β-strand	307-309	3	4
α-helix	312-314	3
β-strand	315-318	4	4
β-strand	351-352	2	6
β-strand	356-361	6	7
β-strand	362	1	8
β-strand	367	1	9
β-strand	372	1	9
β-strand	373-375	3	8
β-strand	379-381	3	8
α-helix	389-392	4
β-strand	400-406	7	7
β-strand	408-409	2	8
β-strand	420-421	2	8
β-strand	428-433	6	7
β-strand	437	1	3
α-helix	438-439	2
α-helix	444-447	4
α-helix	450-455	6
α-helix	456-460	5
α-helix	464-477	14
α-helix	488-491	4
α-helix	494-495	2
β-strand	496	1	10
β-strand	499	1	10
α-helix	502-505	4
α-helix	508-514	7
α-helix	519-521	3
α-helix	524-529	6
β-strand	539-540	2	6
α-helix	552-566	15
α-helix	569-572	4
α-helix	583-590	8
β-strand	593-596	4	11
α-helix	599-601	3
β-strand	608-614	7	12
β-strand	621-625	5	12
β-strand	628-631	4	12
β-strand	634-635	2	13
β-strand	637	1	14
β-strand	640	1	14
α-helix	645-647	3
β-strand	651-654	4	12
β-strand	658-659	2	15
β-strand	660-663	4	11
α-helix	672-676	5
β-strand	686-687	2	11
β-strand	690-691	2	15
β-strand	692-693	2	13
β-strand	698-700	3	12
β-strand	728-738	11	16
α-helix	739-741	3
β-strand	742-744	3	16
β-strand	746	1	17
α-helix	747-749	3
α-helix	755-757	3
β-strand	760-775	16	16
β-strand	776	1	18
β-strand	781	1	18
α-helix	783-785	3
β-strand	795-801	7	16
α-helix	802-807	6
β-strand	816-822	7	16
β-strand	842	1	17
α-helix	843-845	3
β-strand	853	1	16
β-strand	859-862	4	16
α-helix	866-869	4
α-helix	872-874	3
β-strand	899-901	3	19
β-strand	905-907	3	20
α-helix	909-912	4
α-helix	917-920	4
β-strand	929-931	3	20
β-strand	934	1	21
α-helix	943-944	2
β-strand	945	1	21
β-strand	948-950	3	20
α-helix	952-954	3
α-helix	955	1
α-helix	957	1
β-strand	966-968	3	19
β-strand	973-976	4	20
β-strand	982-985	4	20
β-strand	994-996	3	19
α-helix	997-999	3
α-helix	1005-1008	4
β-strand	1009	1	22
α-helix	1012-1016	5
β-strand	1024-1027	4	22
β-strand	1030-1042	13	22
β-strand	1049	1	22
β-strand	1058	1	23
β-strand	1062	1	23
β-strand	1068-1078	11	22
β-strand	1083-1089	7	22
α-helix	1090-1092	3
α-helix	1093-1096	4
α-helix	1101-1111	11
β-strand	1116-1120	5	22
β-strand	1121	1	24
α-helix	1126-1127	2
β-strand	1128	1	24
α-helix	1137-1147	11
β-strand	1154	1	22
β-strand	1156-1161	6	22
α-helix	1173-1174	2
β-strand	1175-1178	4	25
β-strand	1187-1190	4	25
α-helix	1191-1194	4
β-strand	1195-1202	8	22

Chain B: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	27	1	26
α-helix	31-36	6
β-strand	38-39	2	27
α-helix	40	1
β-strand	47-49	3	27
β-strand	52-54	3	27
β-strand	56-68	13	26
β-strand	72-79	8	26
β-strand	82-89	8	26
α-helix	96-98	3
α-helix	104-124	21
β-strand	131-141	11	26
β-strand	144-154	11	26
α-helix	161-173	13
α-helix	174-178	5
α-helix	201-219	19
β-strand	223-225	3	28
α-helix	226-230	5
α-helix	233-239	7
α-helix	242-247	6
α-helix	248-250	3
α-helix	252-254	3
α-helix	255-276	22
β-strand	280-281	2	28
β-strand	290-293	4	28
α-helix	298-309	12
β-strand	322-323	2	29
α-helix	324-334	11
α-helix	341-354	14
β-strand	358	1	30
β-strand	364-365	2	29
β-strand	366	1	30

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	9	1	31
α-helix	12-16	5
α-helix	21	1
β-strand	24-36	13	31
β-strand	41-47	7	31
β-strand	52-58	7	31
β-strand	72-82	11	31
β-strand	86-97	12	31
α-helix	102-118	17

Chain D: 30 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	22-32	11	32
β-strand	36-37	2	32
β-strand	43-50	8	32
β-strand	56-63	8	32
β-strand	78-89	12	32
β-strand	92-96	5	32
β-strand	102-106	5	32
α-helix	127-139	13
α-helix	140-144	5
α-helix	153-155	3
β-strand	160-172	13	33
β-strand	178-184	7	33
α-helix	192	1
β-strand	193	1	33
α-helix	194	1
α-helix	200-202	3
β-strand	204-205	2	33
α-helix	211-216	6
β-strand	217-223	7	33
α-helix	225-232	8
β-strand	238-251	14	33
β-strand	257-265	9	33
α-helix	270-272	3
β-strand	274-278	5	33
α-helix	279	1
α-helix	283-296	14
α-helix	317-321	9
α-helix	332-333	2
β-strand	335-337	3	34
α-helix	344	1
β-strand	345	1	35
α-helix	348-352	5
β-strand	358-370	13	35
α-helix	374-376	3
β-strand	378-382	5	35
β-strand	387-389	3	35
α-helix	390-393	4
α-helix	394-401	8
α-helix	407-409	3
α-helix	411-413	3
β-strand	419-426	8	36
β-strand	432-439	8	36
β-strand	441	1	37
β-strand	444	1	37
α-helix	445-447	3
α-helix	448-450	3
β-strand	452-456	5	36
α-helix	460-467	8
β-strand	472-475	4	36
β-strand	477	1	38
β-strand	484	1	38
β-strand	493-495	3	36
β-strand	498-500	3	36
β-strand	502	1	39
α-helix	512-517	6
α-helix	526-532	7
β-strand	537	1	39
α-helix	538	1
β-strand	539-549	11	35
β-strand	554-561	8	35
α-helix	577-590	14
α-helix	597-599	3
α-helix	601-602	2
β-strand	603-610	8	35
β-strand	621-625	5	35
β-strand	627-629	3	34

Chain E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	176-192	17
α-helix	201-203	3
α-helix	206-214	9
β-strand	215	1	40
β-strand	217	1	40
α-helix	218-220	3
α-helix	231-239	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit CTC1	A	protein	1613	Escherichia coli O157:H7, Homo sapiens	P0AEX9 (AlphaFold model), Q2NKJ3 (AlphaFold model)
CST complex subunit STN1	B	protein	368	Homo sapiens	Q9H668 (AlphaFold model)
CST complex subunit TEN1	C	protein	123	Homo sapiens	Q86WV5 (AlphaFold model)
Protection of telomeres protein 1	D	protein	646	Homo sapiens	Q9NUX5
TPP1	E	protein	529	Human enterovirus 71, Homo sapiens	B6F2F5, Q96AP0
DNA (5'-d(tptpapgpgpgptptpapg)-3')	F	DNA	18	synthetic construct

Sequence of entity 1 (A), FASTA

>8SOK_1 CST complex subunit CTC1 (chains A)
MGSSHHHHHHSSGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEK
FPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAY
PIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGG
YAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTI
NGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLT
DEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTA
VINAASGRQTVDEALKDAQTKLVEKYLEVLFQGPGSMAAGRAQVPSSEQAWLEDAQVFIQ
KTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRNQGSTLPLSYSFVSVQDLKTHQRLPCCSH
LSWSSSAYQAWAQEAGPNGNPLPREQLLLLGTLTDLSADLEQECRNGSLYVRDNTGVLSC
ELIDLDLSWLGHLFLFPRWSYLPPARWNSSGEGHLELWDAPVPVFPLTISPGPVTPIPVL
YPESASCLLRLRNKLRGVQRNLAGSLVRLSALVKSKQKAYFILSLGRSHPAVTHVSIIVQ
VPAQLVWHRALRPGTAYVLTELRVSKIRGQRQHVWMTSQSSRLLLLKPECVQELELELEG
PLLEADPKPLPMPSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLA
YQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSS
RQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGL
QLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAW
ASFDPKALLPLPEASYLPSCQLNRRLAWSWLCLLPSAFCPAQVLLGVLVASSHKGCLQLR
DQSGSLPCLLLAKHSQPLSDPRLIGCLVRAERFQLIVERDVRSSFPSWKELSMPGFIQKQ
QARVYVQFFLADALILPVPRPCLHSATPSTPQTDPTGPEGPHLGQSRLFLLCHKEALMKR
NFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQGNDDNDQKVHLIFFGSS
VRWFEFLHPGQVYRLIAPGPATPMLFEKDGSSCISRRPLELAGCASCLTVQDNWTLELES
SQDIQDVLDANKSLPESSLTDLLSDNFTDSLVSFSAEILSRTLCEPLVASLWMKLGNTGA
MRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYC
CFRSSTYVQVLSFPPETTISIPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCA
YCTSICRQGKCTRLGSTCPTQTAISQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREW
ASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTSPSVLRPIVLSFELERK
PSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLSIRESEYSSSLGILASSC

Sequence of entity 2 (B), FASTA

>8SOK_2 CST complex subunit STN1 (chains B)
MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVL
GTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETI
EQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQ
PFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN
QPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDL
HRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVST
MEHYYTAF

Sequence of entity 3 (C), FASTA

>8SOK_3 CST complex subunit TEN1 (chains C)
MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
LVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERG
GSQ

Sequence of entity 4 (D), FASTA

>8SOK_4 Protection of telomeres protein 1 (chains D)
MHHHHHHGSSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQ
TNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGA
PIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKA
EVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARS
LKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDL
ESANLTANQHSDVICQSEPDDSFPSSGSESDLVSLYEVERCQQLSATILTDHQYLERTPL
CAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKT
PDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSN
KFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSS
VAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMD
MFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI

Sequence of entity 5 (E), FASTA

>8SOK_5 TPP1 (chains E)
MWSHPQFEKGGGSGGGSGGSAWSHPQFEKGSVSKGEELFTGVVPILVELDGDVNGHKFSV
SGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMP
EGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN
VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK
DPNEKRDHMVLLEFVTAAGITLGMDELYKENLYFQGGSMAGSGRLVLRPWIRELILGSET
PSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWE
EKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDL
DVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEGPCTAP
PVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPEL

Sequence of entity 6 (F), FASTA

>8SOK_6 DNA (5'-D(*TP*TP*AP*GP*GP*GP*TP*TP*AP*G)-3') (chains F)
GGTTAGGGTTAGGGTTAG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

POT1 recruits and regulates CST-Pol alpha /primase at human telomeres. Cai, S.W., Takai, H., Zaug, A.J. et al. Cell (2024) 187:3638-3651.e18. DOI 10.1016/j.cell.2024.05.002 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 8SOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.