Crystal structure of legAS4 from Legionella pneumophila subsp. pneumophila with histone H3 (1-12)peptide. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Dec 2023.
Explore 8SWI in 3D Show helices and sheets RCSB PDB PDBe
8SWI contains 28 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 83-86 | 4 | |
| α-helix | 89-95 | 7 | |
| β-strand | 106 | 1 | 1 |
| β-strand | 117-121 | 5 | 2 |
| α-helix | 123-125 | 3 | |
| β-strand | 131-135 | 5 | 2 |
| β-strand | 139 | 1 | 3 |
| β-strand | 144-147 | 4 | 4 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-164 | 10 | |
| α-helix | 170-172 | 3 | |
| β-strand | 173-176 | 4 | 5 |
| β-strand | 179-182 | 4 | 5 |
| β-strand | 187 | 1 | 1 |
| α-helix | 189-192 | 4 | |
| β-strand | 194-195 | 2 | 4 |
| β-strand | 202-209 | 8 | 4 |
| β-strand | 212-219 | 8 | 4 |
| α-helix | 222 | 1 | |
| β-strand | 223 | 1 | 3 |
| α-helix | 224 | 1 | |
| α-helix | 227 | 1 | |
| β-strand | 228 | 1 | 2 |
| α-helix | 229 | 1 | |
| β-strand | 230-231 | 2 | 4 |
| α-helix | 238-243 | 6 | |
| α-helix | 256-262 | 7 | |
| α-helix | 264-266 | 3 | |
| β-strand | 267-271 | 5 | 6 |
| β-strand | 276 | 1 | 7 |
| α-helix | 277-279 | 3 | |
| β-strand | 281 | 1 | 7 |
| β-strand | 286-290 | 5 | 6 |
| α-helix | 291-297 | 7 | |
| β-strand | 318-319 | 2 | 6 |
| β-strand | 320 | 1 | 8 |
| β-strand | 326 | 1 | 8 |
| α-helix | 337-344 | 8 | |
| α-helix | 347-355 | 9 | |
| α-helix | 371-381 | 11 | |
| α-helix | 386-397 | 12 | |
| β-strand | 405 | 1 | 9 |
| β-strand | 411 | 1 | 9 |
| α-helix | 412-419 | 8 | |
| α-helix | 422-435 | 14 | |
| α-helix | 441-443 | 3 | |
| β-strand | 446 | 1 | 10 |
| α-helix | 454-460 | 7 | |
| α-helix | 464-473 | 10 | |
| α-helix | 477-481 | 5 | |
| α-helix | 487-500 | 14 | |
| α-helix | 506-518 | 13 | |
| α-helix | 525-530 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic huntingtin interacting protein B | A | protein | 451 | Legionella pneumophila subsp. pneumophila | Q5ZUS4 (AlphaFold model) |
| Histone H3 peptided | B | protein | 12 | Homo sapiens | P68431 (AlphaFold model) |
>8SWI_1 Eukaryotic huntingtin interacting protein B (chains A) NADEWIDTSKIMLDLHIDNMSSSDYIPSAIDRTDLVMVQSVHLLRKTGGRGLFAREDIPK GTCIGIYTGEVYSEQEFEQYLKEHVGSDKSYAMYVGGRVIDAARKGNLTRYINFSDSQDN AEFVETTLNRKKVAKVITTKNIKAGQQLLINYNTYEEQASRYYYFLNPGDGWLSAQEFYQ TYQSQYRLEQMPYNLEGFDLKAGDRVLMTQIGRIILANYSLAKEQELNASDIDLPFLKVG SDEKILDFDEADTFTPLMAACYLGQVENVKWLIEHGANIDQQQSHSGHCPLSLTLKGYSL AKDTQKYIDIIQLLIKNQVNLLVHDRSDKTFLHNAALVLNNLDFQSVVKFLIGQNPIDIN EYFTYIDENDFDIVMHCYNNKLFDKALVLLAFYPDYFKRNYMSDNEGHNQFNINAFRKAI KDFNSNERSILLMQLRESGLHLPEDLLEQLG
>8SWI_2 Histone H3 peptided (chains B) ARTKQTARKSTG
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
The SET and ankyrin domains of the secreted Legionella pneumophila histone methyltransferase work together to modify host chromatin. Rolando, M., Wah Chung, I.Y., Xu, C. et al. mBio (2023) 14:e0165523-e0165523. DOI 10.1128/mbio.01655-23 · PubMed
Other PDB entries of the same protein (UniProt Q5ZUS4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8SWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.