8SYG: Tetradecameric hub domain of CaMKII alpha

Cryo-EM structure of tetradecameric hub domain of CaMKII alpha. Determined by electron microscopy at 2.6 Å resolution. Released 19 Jun 2024.

Method: Electron microscopy
Resolution: 2.6 Å
Organisms: Aequorea victoria, Rattus norvegicus
Chains: 14
Atoms: 15,218
Mol. weight: 642.29 kDa
Released: 19 Jun 2024

Explore 8SYG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SYG contains 70 α-helices and 84 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M and N: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	346-363	18
α-helix	366-372	7
β-strand	373-380	8	2
α-helix	382-384	3
β-strand	389-390	2	2
α-helix	393-398	6
α-helix	399-403	5
β-strand	410-421	12	2
β-strand	426-438	13	2
β-strand	444-458	15	2
β-strand	461-471	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Venus-tagged CaMKII Alpha Association Domain	A, B, C, D, E, F, G, H, I, J, K, L, M, N	protein	407	Aequorea victoria, Rattus norvegicus	P11275 (AlphaFold model), P42212 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N), FASTA

>8SYG_1 Venus-tagged CaMKII Alpha Association Domain (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N)
MGSSHHHHHHSSGLVPRGSHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG
KLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFF
KDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG
IKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVL
LEFVTAAGITLGMDELYKSGLRSRAQASNSAVDVRKQEIIKVTEQLIEAISNGDFESYTK
MCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAY
IRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH

Primary citation

Hub stability in the calcium calmodulin-dependent protein kinase II. Chien, C.T., Puhl, H., Vogel, S.S. et al. Commun Biol (2024) 7:766-766. DOI 10.1038/s42003-024-06423-y · PubMed

Other PDB entries of the same protein (UniProt P11275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CDM 2.0 Å, Modulation of calmodulin plasticity in molecular recognition on the basis of X-ray…
1CM1 2.0 Å, Motions of calmodulin-single-conformer refinement
1CM4 2.0 Å, Motions of calmodulin-four-conformer refinement
8T15 2.7 Å, Cryo-EM structure of dodecameric hub domain of CaMKII alpha
5U6Y 20.0 Å, Pseudo-atomic model of the CaMKIIa holoenzyme.

Browse structure collections

About this viewer

MolViewer shows 8SYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.